KEGG   Methanococcus maripaludis S2: MMP0148Help
Entry
MMP0148           CDS       T00164                                 

Gene name
acsA
Definition
(GenBank) acetyl-CoA synthetase, AMP-forming
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmp  Methanococcus maripaludis S2
Pathway
mmp00010  Glycolysis / Gluconeogenesis
mmp00620  Pyruvate metabolism
mmp00640  Propanoate metabolism
mmp00680  Methane metabolism
mmp00720  Carbon fixation pathways in prokaryotes
mmp01100  Metabolic pathways
mmp01110  Biosynthesis of secondary metabolites
mmp01120  Microbial metabolism in diverse environments
mmp01130  Biosynthesis of antibiotics
mmp01200  Carbon metabolism
Module
mmp_M00357  Methanogenesis, acetate => methane
mmp_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMP0148 (acsA)
   00620 Pyruvate metabolism
    MMP0148 (acsA)
   00640 Propanoate metabolism
    MMP0148 (acsA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MMP0148 (acsA)
   00680 Methane metabolism
    MMP0148 (acsA)
Enzymes [BR:mmp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MMP0148 (acsA)
Lipid biosynthesis proteins [BR:mmp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MMP0148 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CAF29704
UniProt: Q6M0X0
Position
158021..159931
Genome map
AA seq 636 aa AA seqDB search
MKTGDKYIMLEKYSELQQKALDDPEKFWGEQAKCLEWDKTWDKALDWNPPYAKWFKGGSL
NASYNCVDRHIKGNRRNKAAIICEKEDGSCGILTYYELYREVNKFANVLENLGVEKGDVV
TIYMPMMTEAIIAMLACSRIGAIHNVVFSGFSSDALADRINDSKSKILVTTNLLYRRGKE
IDLKKILDKALLNCNSIKHVVYAKRGIEEFNLVSGKEYFWDELMGGAKSYVEPVPVESEH
PLFILYTSGTTGSPKGVVHSTGGYLTYATKTMDWTWGLNEMDVFWCTADIGWITGHTYVV
YGPLSLGATIVLYEGAIDYPEPDRLWGIVENHGVTILYTAPTAIRMLMMYGEKWVNTHDL
STLRLLGSVGEPINPRAWKWYYKVIGKEKCPICDCYWQTETGGHIIYPPIGIQSVPLKPG
SATFPGIGIDVDVVDNEGNPVDANVKGNLIIKRPWPGMLAGLWNNDERYRAAYWDRFKNK
FSTSDYAIKDQDGYIWVLGRSDEVLNVSGHRIGTAELEHELVSNKMVAESAVVGKPDDVK
GEVPVAFVILNEKYRELPSNEVKAELIKHIRDTVGPIGTPAMIFFVNKLPKTRSGKIMRR
ILKKLIMGEEIGDVTTLEDNTSLEEVKKELEDFKYD
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactggagacaaatacataatgcttgaaaaatattcagaattacagcaaaaagct
ttggatgaccctgaaaaattctggggagagcaggccaaatgtttagaatgggataaaact
tgggataaagcactggactggaatcctccttatgcaaaatggtttaaaggcggcagtttg
aatgcaagctacaactgtgttgataggcacataaaaggaaacaggagaaataaagctgcg
ataatttgcgaaaaagaggatgggagctgcggaattttaacttattacgagttatatcgg
gaagtaaataaatttgcaaacgttcttgagaatctgggcgttgaaaaaggcgatgttgtc
acaatctacatgccgatgatgacagaggcaattattgcaatgctcgcatgttcaagaatt
ggggcaattcacaacgttgtattttctggattttcttcagatgcacttgctgatcggata
aacgattcgaaatcaaaaatattggtgactaccaatctcttatacaggcgtggaaaagag
attgatcttaaaaaaatattggataaagcattattgaattgtaactcaataaaacacgta
gtttatgcaaaaagaggcattgaagaatttaacttagtttctggaaaagagtacttctgg
gatgaattaatgggcggtgctaaaagctacgtagaaccggttcccgtggagtctgaacac
ccgctatttattctctacactagcggtacaactggaagtccaaaaggtgtagttcattca
acaggcggatatttaacttatgccacaaaaaccatggattggacatggggattaaatgaa
atggatgtattttggtgtactgcagacattggatggattactgggcacacttacgtagta
tatggtccgctttcacttggtgcaacgatagtactctacgagggtgcaatagactaccct
gaacccgacagattgtggggtattgtagaaaatcatggggttacaattctttatactgca
ccaaccgcgataagaatgcttatgatgtacggtgaaaaatgggtaaatactcacgattta
tctacattgaggcttttgggaagtgtaggggaacccataaatccaagagcttggaaatgg
tattacaaagtaattggaaaagaaaaatgtccaatttgcgactgctactggcaaactgaa
actggtgggcatattatatatcctccaattggaatccagtcagttccattaaaaccgggt
tcagcaacattccctggaatcggaattgatgttgatgttgtagacaacgaaggaaaccct
gttgatgcaaatgtaaaaggaaatctaattataaaacgaccctggccaggaatgcttgca
ggactctggaacaacgatgaaagataccgtgcggcatattgggataggttcaaaaacaaa
ttttcaacatctgactatgcaataaaagatcaggatggatacatttgggtactaggacga
tctgacgaagtattgaatgtttcaggacacaggattggaaccgcagaactcgaacacgaa
cttgtatcaaataaaatggttgcagagtctgcagtagtcggaaaaccagacgatgtgaaa
ggagaagttcctgttgcatttgttatattaaacgaaaaataccgtgaacttccatcaaat
gaagtaaaggctgaacttatcaaacatattcgagatactgtaggcccaattggaactcct
gcaatgatattctttgtaaacaaacttccaaaaacaagaagtggaaaaataatgagaaga
atattgaaaaaactcataatgggcgaagagataggcgatgttaccacattggaagacaat
acaagtttagaagaagttaaaaaagagcttgaagatttcaagtatgattaa

DBGET integrated database retrieval system