KEGG   Methanococcus maripaludis S2: MMP0687Help
Entry
MMP0687           CDS       T00164                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmp  Methanococcus maripaludis S2
Pathway
mmp00010  Glycolysis / Gluconeogenesis
mmp00051  Fructose and mannose metabolism
mmp01100  Metabolic pathways
mmp01110  Biosynthesis of secondary metabolites
mmp01120  Microbial metabolism in diverse environments
mmp01130  Biosynthesis of antibiotics
mmp01200  Carbon metabolism
mmp01230  Biosynthesis of amino acids
Module
mmp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmp_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mmp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMP0687 (tpiA)
   00051 Fructose and mannose metabolism
    MMP0687 (tpiA)
   00562 Inositol phosphate metabolism
    MMP0687 (tpiA)
Enzymes [BR:mmp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MMP0687 (tpiA)
Exosome [BR:mmp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MMP0687 (tpiA)
  Exosomal proteins of bladder cancer cells
   MMP0687 (tpiA)
  Exosomal proteins of melanoma cells
   MMP0687 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG FMN_dh His_biosynth IGPS NMO
Motif
Other DBs
NCBI-ProteinID: CAF30243
UniProt: Q6LZE2
Position
675181..675702
Genome map
AA seq 173 aa AA seqDB search
MILDEVNIPVYAQHMDAVTPGSSTGHILPDALKDAGVTGTLLNHSERRMLLADLEKCIEI
SNKLGLKTVVCTNNIPVSKAVSALNPTSIAVEPPELIGSGIPVSKANPEVVSGTVREVRE
INKNVEILCGAGISKGEDVKSALELGTNGVLLASGVVKAKNVEDAIRELIAEI
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgattttagatgaagtaaatattcctgtttatgcgcaacacatggatgcagtaactcct
ggaagcagtactggacatatattgcctgatgcattaaaagatgcaggagttacaggaact
cttttaaaccactctgaaagaagaatgcttcttgcagaccttgaaaaatgcattgaaatt
tcaaataagctcggattaaaaacggttgtatgcacaaacaacatacctgtttcaaaagca
gtttctgcgttaaatccaacttcaattgcagtagaacctccagaattgattggaagcgga
atacccgtttcaaaagcaaatcctgaagtagtatctggaactgttcgagaggttcgagaa
attaataaaaacgttgaaatattgtgtggtgcaggtatatcaaaaggagaagatgtaaaa
tctgcgcttgaacttggaacaaacggtgttttgcttgcatcaggtgttgtaaaagctaaa
aacgtcgaagatgcaataagagaattaattgcagaaatttaa

DBGET integrated database retrieval system