KEGG   Methanococcus maripaludis S2: MMP1487Help
Entry
MMP1487           CDS       T00164                                 

Gene name
gapN
Definition
(GenBank) Aldehyde dehydrogenase
  KO
K19266  lactaldehyde dehydrogenase [EC:1.2.1.22]
Organism
mmp  Methanococcus maripaludis S2
Pathway
mmp00620  Pyruvate metabolism
mmp01100  Metabolic pathways
mmp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MMP1487 (gapN)
Enzymes [BR:mmp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.22  lactaldehyde dehydrogenase
     MMP1487 (gapN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CAF31043
UniProt: Q6LX65
Position
1446303..1447700
Genome map
AA seq 465 aa AA seqDB search
MFIDGKWIIREDIDVFDPYTLENIEKITALDREETKNAIEVTEKHKEIMKNLSPSKRYKI
LMKVAEHLSSKKDFFAKTISIDVGKPIKQSKIEVDRTLTALKLSAFYAKELRGETINSEN
GLIFTKKEPLGVIGAITPFNFPLNLATHKIGPAIATGNSVVLHPSSKAPIVAIYLTKIIE
HVLKQMDIPRGVFNLATGNGEIVGDEISKNDNVNMVSFTGSVEVGESISKNAKMKKVTLE
LGGNNPMIVLKDSDIKLAAKSAVKSKFLNAGQVCISVGQVLVEEEVVETFTKYVIEETKK
LILGNPLDKNTDIGPLISPESALRIENLIKQSVSEGGELLIGGNRQNSLISPAVINIDEE
NILSKIETFGPILPILTVKDSEEAVNIANNSKYGLQAGLFTNNINNAMKIADELEYGGIM
INSSPTFRKDNMPFGGVKKSGLGREGIKYTVEEMSETKTVVIHNI
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtttatcgatggaaaatggattataagggaagatattgatgtttttgacccatacact
cttgaaaatattgaaaaaataactgcacttgatagggaagaaactaaaaatgcaattgaa
gttactgaaaaacataaagaaataatgaaaaatttaagcccgtcaaaaagatataaaata
ttgatgaaagttgctgaacatctaagttcgaaaaaagacttttttgcaaaaacaatttca
atcgatgttggaaagccaataaaacagtcaaaaatagaagtagataggacattaactgcg
ctcaagctttctgcattttatgcaaaggaactccgtggggaaacaattaattcagaaaat
ggccttatatttactaaaaaagaacctttaggcgtaattggagcaattactccatttaat
tttccattaaatctggctacacacaaaattggtcctgcaattgccacaggaaactcggtt
gtgctccacccatcatcaaaagcgcccattgtagcaatatatcttacaaaaattatagaa
catgtcttaaaacagatggatattccaaggggggtatttaatcttgcaacaggaaatggg
gaaattgttggagatgaaatatcgaaaaacgataatgtaaacatggtttctttcacagga
agtgttgaagttggggaatcaatatctaaaaatgcgaaaatgaaaaaagttacactcgaa
cttgggggaaataaccctatgatcgtgttaaaagattccgatattaaactagctgctaaa
tctgcggttaaaagtaaatttttaaatgcaggacaggtttgtatctcggttggacaggta
ctcgttgaagaagaagttgttgaaacatttacaaaatatgttattgaagaaaccaaaaaa
ctaattttgggaaatccactcgataaaaatacagacattggaccacttataagcccggag
agtgctttaagaattgaaaatttgataaaacagtcagtaagtgagggcggagaattgtta
attggtggaaatcggcaaaacagtttaatttcccctgccgtcattaatatcgatgaagaa
aatatattatcaaaaattgaaacctttggaccaattcttccaatattaactgttaaagat
agtgaagaagcagtaaatattgcaaataattctaaatacggacttcaagctggcttattt
acaaataatataaataatgcgatgaaaatagccgatgagcttgaatacggtgggataatg
attaacagcagtccaacatttagaaaagacaacatgccctttgggggagttaaaaaaagc
ggtcttggaagggaaggaataaaatatacagttgaagaaatgtctgaaacaaaaacagtc
gtaattcataacatttaa

DBGET integrated database retrieval system