KEGG   Methanococcus maripaludis S2: MMP1511Help
Entry
MMP1511           CDS       T00164                                 

Definition
(GenBank) Sodium:alanine symporter
  KO
K03310  alanine or glycine:cation symporter, AGCS family
Organism
mmp  Methanococcus maripaludis S2
Brite
KEGG Orthology (KO) [BR:mmp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    MMP1511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_Ala_symp
Motif
Other DBs
NCBI-ProteinID: CAF31067
UniProt: Q6LX42
Structure
PDB: 

Position
complement(1468938..1470299)
Genome map
AA seq 453 aa AA seqDB search
MDFVSLVNTVNSFVWGPYMLVLLLGTGIFLTLRLGFMQIHTLPYALKLAFSKHQDETSEG
DISHFQALMTALAATIGTGNIAGVATAYVLGGPGAIFWMWVTAFFGMATKYAEAVLAIKY
RTVDDNGEMAGGPMYFLEKGLPDHGLGKILGVAFAFFGAFAAFGIGNMVQTNSVADAVAS
NFGVDPLITGFVLAIFTAAVILGGIKSIGKATGIIVPFMAVFYILAGLVILAMNIGYIIP
AFGTIFSSAFNFSAGFGALIGTAIMWGVKRGVFSNEAGLGSAPIAAAAAKTDHPGRQALV
SMTGTFLDTIVVCTITGLVLTIAGLKAFPGLTDLTGASLTAASFDALMPMGGLIVTIGLV
FFAYSTVLGWSYYGEKCFEYLIGTKGIRLYRIAFVLVAFWGATASLPLVWNIADTLNGAM
AIPNLIGLLLLSGVVVSETKAFNEIRKNEAKNA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggattttgtttcacttgttaatacagttaacagttttgtttggggtccttacatgctc
gtacttcttttgggtacagggatctttttaacattgagattaggttttatgcaaattcac
acgttgccttatgcattaaaacttgcattttcaaaacatcaagatgaaacttcagaaggg
gacatctcacactttcaggcattgatgactgcgcttgcagcaacaatcggtactggaaac
atcgcaggggttgcaacagcatacgttcttggtggacctggcgcaatattctggatgtgg
gtcacagcattctttggaatggctacgaaatatgcagaagcagttcttgcaattaaatac
agaactgtcgatgacaacggagaaatggcaggaggtccaatgtacttccttgaaaaagga
cttccagaccacggacttggaaaaattttaggggttgcatttgcatttttcggtgcattt
gctgcatttggtattggtaacatggttcaaacgaactcagttgctgatgcagtggcttca
aactttggtgttgatccattaattacaggatttgttcttgcaatattcacagctgcagtt
attttgggcggtattaaaagtatcggtaaagctacaggtattatcgtacctttcatggca
gtattttacatattggcaggattagtaattcttgcaatgaatattggttacattattcca
gcgtttggaacaatattctcttcagcatttaacttcagcgcaggattcggtgcattaatt
ggtactgcaatcatgtggggggttaaaagaggtgtattctcaaacgaagcaggtcttggt
tccgcaccaattgcagcagcagctgctaaaacagatcaccctggaagacaggcattagtt
tcaatgactggtacattcctcgatacaattgttgtatgtacaattacaggattagtttta
acaatcgcaggtttaaaagcattccctggtcttacagacttaacgggtgcatctttaacc
gcagcttcatttgatgcattaatgccaatgggtggattaatcgttacaatcggtcttgta
ttctttgcatactcaactgtgcttggatggtcgtactacggtgaaaaatgtttcgaatat
ttaattggtacaaaaggaattagactgtacagaatagcattcgttttagttgctttctgg
ggtgcaaccgcaagcttaccacttgtatggaacattgcagataccttaaacggagcaatg
gcaattccaaacttgattggtttgttgttactttccggtgtagtagttagcgaaacaaaa
gctttcaacgaaataaggaaaaatgaagctaaaaacgcttaa

DBGET integrated database retrieval system