KEGG   Methanococcus maripaludis C5: MmarC5_0021Help
Entry
MmarC5_0021       CDS       T00491                                 

Definition
(GenBank) methyl-coenzyme M reductase, beta subunit
  KO
K00401  methyl-coenzyme M reductase beta subunit [EC:2.8.4.1]
Organism
mmq  Methanococcus maripaludis C5
Pathway
mmq00680  Methane metabolism
mmq01100  Metabolic pathways
mmq01120  Microbial metabolism in diverse environments
mmq01200  Carbon metabolism
Module
mmq_M00357  Methanogenesis, acetate => methane
mmq_M00567  Methanogenesis, CO2 => methane
mmq_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mmq00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MmarC5_0021
Enzymes [BR:mmq01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.4  Transferring alkylthio groups
    2.8.4.1  coenzyme-B sulfoethylthiotransferase
     MmarC5_0021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCR_beta MCR_beta_N CAF1-p150_N
Motif
Other DBs
NCBI-ProteinID: ABO34338
UniProt: A4FVX0
Position
complement(14899..16230)
Genome map
AA seq 443 aa AA seqDB search
MVKYDDKISLYDAKGNLVADNVPLEAISPLYNPTIKNMVKNIKRTVAVNLAGIESTLAAG
KIGGKGCQVPGRTLDISAVSNAQAIADEVEKILKVSEDDDTAVKLVNGGKQLAVQVPTAR
LEVAAEYSVSMLSTAMALKEALIKTFDIDMFDGSTVHAAIVGNYPQVMDYAGGNIASLLG
APSNMEGLGYALRNIPVNHAVATTKKNMMNAIAFSSVMEQTATFEMGDAVGSFERQHLLG
LAYQGLNADNLVIDFIKANGKGTVGSVVETVVERAIADGVIVVDKTMSSGFNMYKPADVN
KWNAYAAAGLVAAVAVSCGAARAAQNVASVILYFNDILEYETGLPGVDYGRSMGTAVGFS
FFSHSIYGGGGPGIFNGNHVVTRHSKGFAIPPVCAAMCADAGTQMFSPETTSGLVGAVYS
AFDEFREPMKYVIEGALSIKDQF
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagtatgatgataagatcagtttgtacgatgcgaaaggaaacctagtagccgac
aatgtaccattagaagctattagcccattatataatcctaccatcaaaaacatggtaaag
aacattaaaagaaccgttgctgtaaacctcgctggtattgaaagtaccttagctgcaggt
aaaatcggtggaaaaggatgccaagttccaggaagaactttggacatatccgcagtaagc
aatgctcaggctattgctgacgaagtagaaaaaatcttaaaagtatccgaagatgacgat
acagcagtaaaattagttaacggcggaaagcagttagctgtgcaagttccaaccgcaaga
ttggaagtagctgcagaatactcagtatcaatgctttcaaccgctatggcattgaaagaa
gcacttattaaaacattcgacattgacatgttcgatggttcaacagtgcacgctgcaatt
gttggtaactacccacaggttatggattacgcaggcggtaacattgcgtcacttttaggt
gcaccttcaaacatggaaggtttaggttacgctttaagaaatattccggttaaccacgcg
gttgctacaaccaagaaaaacatgatgaacgctattgcattctcatcagttatggaacag
actgcaacattcgaaatgggtgacgcagtaggatcattcgaaagacagcatttacttggt
ttagcttaccaaggattaaacgctgataatttagttattgactttattaaagcaaatgga
aaaggaactgttggttcagttgttgaaacagttgttgaaagagcaattgctgacggcgta
attgttgttgacaaaacaatgagctcaggattcaacatgtacaaaccagctgacgtaaac
aaatggaatgcttacgcagcagcaggtttagttgcagcagttgcagtaagctgtggtgca
gcaagagcagcacaaaacgttgcttcagttattttatacttcaacgatattctagagtac
gaaaccggtttacctggtgttgactacggtagatcaatgggtactgcagtaggattctca
ttcttctcacactcaatctacggtggcggtggacctggtatcttcaacggtaaccacgtt
gtaaccagacactccaaaggattcgctattcctccagtatgtgcggcaatgtgtgcagat
gcaggtacacagatgttctcccctgaaactacttcaggattagttggtgcagtatactca
gcattcgacgaattcagagaaccaatgaaatacgtaattgaaggagctttaagcattaaa
gaccaattttaa

DBGET integrated database retrieval system