KEGG   Methanococcus maripaludis C5: MmarC5_0073Help
Entry
MmarC5_0073       CDS       T00491                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
mmq  Methanococcus maripaludis C5
Pathway
mmq00010  Glycolysis / Gluconeogenesis
mmq00020  Citrate cycle (TCA cycle)
mmq00620  Pyruvate metabolism
mmq00633  Nitrotoluene degradation
mmq00640  Propanoate metabolism
mmq00650  Butanoate metabolism
mmq00680  Methane metabolism
mmq00720  Carbon fixation pathways in prokaryotes
mmq01100  Metabolic pathways
mmq01120  Microbial metabolism in diverse environments
mmq01130  Biosynthesis of antibiotics
mmq01200  Carbon metabolism
Module
mmq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mmq_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC5_0073
   00020 Citrate cycle (TCA cycle)
    MmarC5_0073
   00620 Pyruvate metabolism
    MmarC5_0073
   00640 Propanoate metabolism
    MmarC5_0073
   00650 Butanoate metabolism
    MmarC5_0073
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MmarC5_0073
   00680 Methane metabolism
    MmarC5_0073
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MmarC5_0073
Enzymes [BR:mmq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MmarC5_0073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: ABO34390
UniProt: A4FW19
Position
62294..63190
Genome map
AA seq 298 aa AA seqDB search
MTGSQFPREELFAPGHRGCAGCGAAIVARLALKAAGKNTIVANATGCLEVMTTPYPETAW
RVPWIHVAFENAAAVASGIEGAVVALKRKKGKYGEEKVNVIAFGGDGGTADIGFQALSGA
MERGHDMVYIMYDNEAYMNTGVQRSGSTPFMASTTTSPAGSHIRGENRPKKDMPMIMAAH
GIPYIATASISYPEDFMNKVKKACEVNGPAFIQVLQPCTTGWGYPAENTVEMGRLAVETG
VWPLFEIENGEFKLNYKPLKRKPIEEYLKVQKRYRHLKPEDISVIQETIDMKCDEYGL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgactggaagccaatttccaagagaagaattatttgctccaggacacaggggctgtgca
ggttgtggtgcagcaattgtcgcaagactcgctttaaaagctgctggaaaaaatacaatc
gttgcaaatgctaccggatgtcttgaggttatgacaacaccttatcctgaaactgcgtgg
agagttccttggattcacgttgcatttgaaaatgctgctgcagtagcaagtggtattgaa
ggagcggtagttgctttaaaaagaaagaaaggaaaatacggcgaagaaaaagtaaacgtc
attgcatttggtggtgatggtggtactgcagatatcggttttcaagcattaagtggtgca
atggaaagaggacatgatatggtatacatcatgtacgataacgaagcttacatgaacaca
ggcgttcaaagaagtggttcaacacctttcatggcatcaacaacaacatcgcctgctgga
agccatatccgtggagaaaacaggcctaaaaaagacatgccaatgatcatggctgctcac
ggaattccttatattgcaacagcatcaataagctatcctgaagacttcatgaacaaagtt
aaaaaagcatgcgaagtaaacggccctgcattcattcaggtacttcagccatgtactact
ggttggggataccctgctgaaaacacggttgaaatgggtagacttgcagttgaaactggt
gtttggccacttttcgaaattgaaaatggtgaatttaagttaaattacaagccattgaaa
agaaaaccaattgaagaatacttaaaagtgcagaaaagatacagacacttaaaacccgaa
gatatttcagtaatccaagagaccatcgacatgaaatgcgacgaatacggtctttaa

DBGET integrated database retrieval system