KEGG   Methanococcus maripaludis C5: MmarC5_0090Help
Entry
MmarC5_0090       CDS       T00491                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K19266  lactaldehyde dehydrogenase [EC:1.2.1.22]
Organism
mmq  Methanococcus maripaludis C5
Pathway
mmq00620  Pyruvate metabolism
mmq01100  Metabolic pathways
mmq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MmarC5_0090
Enzymes [BR:mmq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.22  lactaldehyde dehydrogenase
     MmarC5_0090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABO34407
UniProt: A4FW36
Position
complement(78940..80337)
Genome map
AA seq 465 aa AA seqDB search
MFIDGKWILREDIDVFDPYTLENIEKITALDREETKSAIEVAEKNKEIMKNLSPSKRYSI
LMKIAEQISLKKDLFAKTISIDVGKPIKQSKIEVDRTLTALKLSAFYAKELRGETINSEN
GLIFTKKEPLGVVGAITPFNFPLNLITHKIGPAIATGNSVVLHPSSKAPIVAIYLTKIIE
HVLKQMDVPRGIFNLATGNGDIVGDEISKNDNINMVSFTGSVEVGESISKNAKMKKVALE
LGGNNPMIVLKDSDIKLAAKSAVKSKFLNAGQVCISVGQVLVEEEVLETFTKHVIEETKK
LILGNPLDTKTDIGPLISPESALRIENLIKKSVNEGGEVLIGGNRQNSLISPAVINIDEN
NILSKIETFGPVLPILKVKDSEEAVSIANNSKYGLQAGVFTNDINKAMKIADSLEYGGIM
INSSPTFRKDNMPFGGVKKSGLGREGIKYTVEEMCETKTIVIHNI
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtttatcgatggaaaatggattttaagagaagatatcgatgtttttgacccgtacacg
ttggaaaatatcgagaaaataactgcccttgatagagaagaaacaaaaagtgcgattgaa
gttgcggaaaaaaataaagaaataatgaaaaatttaagcccttcaaaaagatacagtatt
ttaatgaagattgcagagcagatcagcttgaaaaaagatctttttgcaaaaacaatttca
attgacgttggaaaaccaataaaacagtcaaaaatagaagtagatagaacattgactgca
cttaagctttctgcattctatgcaaaggaacttcgtggagaaacaattaattcggaaaat
ggattaatatttacaaaaaaagagccgttgggcgtagttggagcaataactccatttaat
tttccattaaatttgataacacataaaattggccctgcaattgccacaggaaattcagtt
gtattacatccatcatcaaaagcaccgattgttgcaatatatcttacaaaaattatagaa
catgttctaaaacagatggatgttccaagaggaatatttaaccttgctaccggaaatgga
gatattgttggcgatgaaatctcgaaaaacgacaatataaatatggtttcgttcactgga
agcgttgaagttggagaatcgatatcaaaaaatgcgaaaatgaaaaaagttgcacttgaa
cttgggggaaataaccctatgatagtgttaaaagattctgacatcaaattagctgccaaa
tccgcggttaaaagtaaattcttaaatgcggggcaggtttgtatctcagttggacaggtg
ctcgttgaagaagaagttttagaaacatttacaaaacacgttatcgaagaaactaaaaaa
ctaattttgggaaatccgctcgatactaaaacagatatcggcccactcattagtcctgaa
agtgccttaagaattgaaaatttaataaaaaaatccgtaaatgaaggtggagaagtattg
attggcggaaataggcagaacagcttgatttctccggctgtcatcaatattgatgaaaat
aatattttatcaaaaattgaaactttcggaccggttttaccaatattaaaagtaaaggat
agcgaagaagcagtatctattgcaaataattcaaaatatgggcttcaagcaggagtattc
acaaatgatataaataaagctatgaaaatagcagattcattagaatacggcggaataatg
ataaacagcagccccacatttagaaaagacaatatgccttttggaggagttaaaaaaagt
ggtcttggaagagaaggcataaaatataccgtagaagaaatgtgcgagacaaaaacaatt
gtaattcataacatttaa

DBGET integrated database retrieval system