KEGG   Methanococcus maripaludis C5: MmarC5_0104Help
Entry
MmarC5_0104       CDS       T00491                                 

Definition
(GenBank) Isoleucyl-tRNA synthetase
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
mmq  Methanococcus maripaludis C5
Pathway
mmq00970  Aminoacyl-tRNA biosynthesis
Module
mmq_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mmq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MmarC5_0104
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmq01007]
    MmarC5_0104
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmq03016]
    MmarC5_0104
Enzymes [BR:mmq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     MmarC5_0104
Amino acid related enzymes [BR:mmq01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MmarC5_0104
Transfer RNA biogenesis [BR:mmq03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MmarC5_0104
 Prokaryotic Type
   Other AARSs
    MmarC5_0104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1e tRNA-synt_1f tRNA-synt_1_2 DUF1036
Motif
Other DBs
NCBI-ProteinID: ABO34421
UniProt: A4FW50
Position
complement(91679..94783)
Genome map
AA seq 1034 aa AA seqDB search
MKQVKSVNFRELDKKIKEYWETENIYKKVKALNEQGPEYYFVDGPPYCSGAIHLGTAWNK
IIKDTVLRFKRIQGYNVLDKAGWDMHGLPIEVKVENEFNIGSKKDIETKIGTLEFINKCK
EFALNHLEFMEVQFKNLGVWLDFENAYMPIKRDYMEMGWWTLKKAHEKDLLTKDLRSGYW
CPRCETSLAEHEVRGEYKEVLDPSVYVKFKLEKSDEYITIWTTTPWTLPSNMLVCVNPEF
DYAYVNVEFENGNVETWVIAEKLVNDVMKKAEKNNEISKFSISKVVKGDSLIGLKYIHPL
LEENEKQQEFAKIENVHTIVPGDHVTLEGGTGLVHTAPGFGEDDFNIGKKYNIPVYAPID
DNGRYIDSIWKGTFVKDMNESVIETLISKNLLVNSGKVKHTYPHCWRCKTPLLFRATEQW
FLSISKIKESIIEQGKTVDWVPDWVKTRYVNGVSFVGDWNISRQRYWGIPLPIWICEECG
NYEVIGSVDELTQRANEKDLDLSDIHKPAVDNITLTCSCGGKMKRTPDVLDVWYDSGLAP
YASIGSKTLKKAKFITEGNDQVTKWFYSQHALSAVVFDDTSYEKCMMHGFTLDETGEKMS
KSLGNIVSPDDVTEQYGADVLRFYLLSANKAWEDLRFSYSEMDETRSMLNTLWNSYAFSA
NYMVLDDFVPNDEYFKHVKDEDAWILSRINTVAKEAVEALEKPHLHTYTWTLRDFILNDF
SRWYIKLIRDRTWMEKNDVQKLSAYQTLYYVIMKLISIMAPVTPHLSEEIYQNLKTEDMP
ESIFMNKLTIESEFINETLEKDTEIIREIVDSILKGRDKAKYTLRYPITKITLPENIAET
IEKYGYIIKEQGNVKEIELKEFEGNVTVKPDFKELGKIFRSDVPKVVAAINSVDPKELKE
NLKSGEFEISEYVLKPEYVEFRVEIPENIIGVEFSKGNVYINIDMNDEVITEGLVREVIR
RIQSMRKDMDLDINEKINVKLEGLDFSSDYLNHIANEVRGNFVDSLKSDYNQKWTIKTPN
EETYDISIDIEKMK
NT seq 3105 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagtcaaatccgtaaattttagagaattggacaaaaaaataaaagaatactgg
gaaacagaaaatatctacaaaaaagtaaaggcattaaacgaacaaggtcctgaatactat
tttgttgacggtcctccgtactgttctggtgcaatacacctcggaactgcttggaataaa
attataaaggatactgttttaagatttaaaagaattcaaggatacaacgttttagataaa
gctggatgggacatgcacgggcttcctatcgaagttaaagtggaaaatgaatttaatatc
ggctctaaaaaggatattgaaacaaaaatcggaactttagaatttataaacaaatgtaaa
gagtttgcattaaaccacctcgaattcatggaagttcagtttaaaaatttaggtgtatgg
ctagattttgaaaatgcatacatgccaatcaaaagagattacatggaaatgggctggtgg
acgcttaaaaaagctcacgaaaaagatttacttacaaaagacttgagatcaggatactgg
tgcccaagatgtgaaacttcgcttgctgaacatgaagtaaggggggaatacaaagaagta
ctcgacccttcagtttatgtaaaattcaaacttgaaaaaagcgatgaatacatcacaatc
tggactacaactccgtggacccttccttcaaacatgcttgtatgtgtaaatcctgaattt
gattatgcatatgttaatgttgaatttgaaaatggaaacgttgaaacatgggttattgct
gaaaaattagtaaacgacgtaatgaaaaaagctgaaaaaaacaatgaaatttcaaaattc
agtatttcaaaagtagttaaaggagattcattaattggattaaaatatattcacccactc
cttgaagaaaatgaaaaacagcaagaatttgcaaaaatagaaaatgtgcatacaattgtt
cctggagaccacgtaactcttgaaggcggaactggtttagttcacaccgcaccaggattt
ggtgaagacgactttaatattggtaaaaaatacaatattccagtatatgccccaattgat
gataacggaagatatatcgatagcatttggaaaggaactttcgtaaaagatatgaatgaa
tcagttattgaaacattgatatccaaaaatttactcgtaaactctggaaaagtaaaacac
acctacccgcactgctggagatgcaaaacaccacttttattcagggcaaccgaacagtgg
ttcctttcaatatcaaaaataaaagaatccattattgaacagggtaaaactgttgactgg
gttccagactgggttaaaacaagatacgttaacggagtaagttttgttggagactggaac
atctcaagacaaagatactggggaattccacttccaatctggatatgtgaagaatgtgga
aattatgaagtaatcggttcagttgatgaattaacacaaagagctaacgaaaaagattta
gatttaagcgatatccacaaacctgcagttgataacattactttgacatgctcttgtggc
ggaaaaatgaaaagaactccagacgttttagatgtttggtatgacagtggtttggcacca
tacgcgtcaattggatccaaaactcttaaaaaagctaaatttattactgaaggaaacgac
caagttacaaaatggttctactcacagcacgcattaagtgcagtggtatttgacgatact
tcttacgaaaaatgtatgatgcacgggttcacacttgatgaaaccggagaaaaaatgagt
aaatccttaggaaacattgtaagccctgatgacgttacagaacagtacggtgcagatgtt
ttaaggttttaccttttaagtgcgaacaaggcatgggaagatttaagattttcatactcc
gaaatggatgaaaccagaagtatgttaaatacgctctggaattcgtacgcattctctgca
aactacatggttcttgatgatttcgttccaaatgacgaatatttcaagcatgttaaagat
gaagatgcatggatattgagcagaataaacaccgttgctaaagaggctgttgaagcttta
gaaaaacctcatttgcatacgtacacatggacacttagagattttatacttaacgacttt
tcaagatggtacattaaattaattcgtgacagaacttggatggagaaaaacgacgtacag
aaattatctgcataccagaccctatactatgttatcatgaaattaatttcaataatggct
ccggtaacaccgcacctttcagaagaaatctaccagaacttgaaaacagaagatatgcct
gaaagcatctttatgaacaagttaacaattgaatctgaatttataaatgaaactcttgaa
aaagatactgaaattatcagagaaattgtagattcaatcctaaaaggaagagataaagca
aaatacaccttaagatatccaattacaaaaataacgcttcctgaaaacattgctgaaaca
attgaaaaatacggatacatcataaaagaacaaggaaacgtaaaagaaatcgaactaaaa
gaattcgaaggaaatgtaaccgtaaaaccagacttcaaagagcttggaaaaatattcaga
agcgacgttccaaaagtggttgctgcaataaactcagtagatccaaaagaactcaaagaa
aacttgaaatccggagaatttgaaatttctgaatatgttttaaaaccagaatacgttgaa
ttcagagttgaaatccctgaaaatatcatcggtgtagaattttcaaaaggaaacgtttac
atcaacattgacatgaacgatgaagtaatcaccgaaggattggttagagaagttattaga
agaatccaatcaatgagaaaagatatggatttggatattaacgaaaaaatcaatgttaaa
ctagaaggactcgatttcagtagcgattacctgaatcatatcgcaaatgaagttagagga
aacttcgttgatagtttaaaatcagattacaatcaaaaatggacaataaaaactccaaat
gaagaaacttacgatatctcaatcgatattgaaaaaatgaaataa

DBGET integrated database retrieval system