KEGG   Methanococcus maripaludis C5: MmarC5_0146
Entry
MmarC5_0146       CDS       T00491                                 

Definition
(GenBank) Adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
mmq  Methanococcus maripaludis C5
Pathway
mmq00230  Purine metabolism
mmq00250  Alanine, aspartate and glutamate metabolism
mmq01100  Metabolic pathways
Module
mmq_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:mmq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    MmarC5_0146
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MmarC5_0146
Enzymes [BR:mmq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     MmarC5_0146
SSDB
Motif
Pfam: Adenylsucc_synt CytochromB561_N
Other DBs
NCBI-ProteinID: ABO34463
UniProt: A4FW92
Position
123315..124328
AA seq 337 aa
MTCTIVVGGQWGDEGKGKIISYLCKKDNPSIIARGGVGPNAGHTVEVDGEKYGIRMVPTG
FPNVNAKLAVGAGVLTDPEVLLKEIKMLEKFNVGERMIIDYRCGIIEDVHKETDKSNEHL
SKEIGSTGTGCGPANVDRAMRTLKQGKDVESISKYLGDVSEEVNEALESGDNVLIEGTQG
SLLSLFYGSYPYVTSKDTNAASFAADVGVGPTKIDEVVAVFKSYPTRVGEGPFPTEMTVE
EAESLGVVEYGTVTGRRRRVGYFDHDLAKKVCRLNGATQIAITCLDKYDTDCYGIIEYDK
LSEKGKAFIKEVEEKVGVKVTLISTGPELGQTIDVRK
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgacatgtaccatagtagttggtggccaatggggcgacgaaggaaagggaaaaataata
agctacctctgtaaaaaagacaacccgtcaattattgcaagaggcggtgtaggccctaat
gcaggacacactgttgaagtagacggagaaaaatacggaataagaatggttccaaccggt
tttccaaatgttaacgcgaaactcgccgttggtgctggagttttaactgatccagaagtt
ttactcaaagaaatcaaaatgctcgaaaagttcaatgtcggagaaaggatgataattgac
tacaggtgtggtatcattgaagatgttcacaaagaaactgataaatcaaacgaacacctt
tcaaaagaaattggatcaactggaacaggatgtggtcctgcaaatgttgacagagcaatg
agaacattgaaacaaggaaaagacgtagaatcaatttccaaatacctcggagatgtttca
gaagaagtgaatgaagcgctggaatctggagataacgtattaatcgaaggtactcaagga
tccctcttatcattattctacggaagctacccttacgttacctcaaaagatacaaatgca
gcatcttttgcagcagatgtgggtgtaggtcctacaaaaattgacgaagtcgttgcagta
ttcaaatcctaccctacaagagttggtgaaggacctttcccaacagaaatgactgtggaa
gaagctgaaagtctcggagtcgttgaatacggaaccgttactgggaggagaagaagagtt
ggttacttcgatcatgatcttgctaaaaaagtatgcagattaaacggagcaacccaaata
gcaataacatgtcttgataagtatgatactgactgttatggcataatagaatacgataaa
ttatctgaaaaaggtaaggcattcataaaagaagttgaagaaaaagttggcgttaaggta
actcttatttcaacaggtcctgaacttggacagactatcgatgttagaaaataa

DBGET integrated database retrieval system