KEGG   Methanococcus maripaludis C5: MmarC5_0479Help
Entry
MmarC5_0479       CDS       T00491                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mmq  Methanococcus maripaludis C5
Pathway
mmq00020  Citrate cycle (TCA cycle)
mmq00640  Propanoate metabolism
mmq00660  C5-Branched dibasic acid metabolism
mmq00720  Carbon fixation pathways in prokaryotes
mmq01100  Metabolic pathways
mmq01110  Biosynthesis of secondary metabolites
mmq01120  Microbial metabolism in diverse environments
mmq01130  Biosynthesis of antibiotics
mmq01200  Carbon metabolism
Module
mmq_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MmarC5_0479
   00640 Propanoate metabolism
    MmarC5_0479
   00660 C5-Branched dibasic acid metabolism
    MmarC5_0479
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MmarC5_0479
Enzymes [BR:mmq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MmarC5_0479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A DUF5097 DUF3879
Motif
Other DBs
NCBI-ProteinID: ABO34793
UniProt: A4FX64
Position
complement(435282..436370)
Genome map
AA seq 362 aa AA seqDB search
MKLHEYEAKEIFKENGIPVPKNKLTCGKVDSIEYPVVIKAQVLVGGRGKAGGILFADNLD
DANKKIESLIGNTVKGELVEKVLLDEQIKIAKEYYVGVVVNRNEKNNVVIFSTEGGVDIE
EVASKTPEKIIKLPLESGKEFLPYLAREMLKKAGIPSAEIPKVADVLCKVYKAFKNMDGI
LAEINPLVFTEDGKIIAADAVLNIDDDAYFRHKYDKFEEFKKQEKSEFAYVELDGDIAVI
GNGAGLTLASMDIVKEFGGEPACFLDVGGGSNRETVKKALLKATSRKNVKGAFINILGGI
TRCDEVSLGIVDVLKENPNLKFAVRMMGTNEEKGRKILSENGVSFENSMEGAARALTELI
NS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcacgaatatgaagcaaaggaaatttttaaagaaaatggaatccctgttcca
aaaaacaaacttacatgcggtaaagtcgacagtatcgagtaccctgtcgttataaaagcg
caagtattagtcggtggaagaggaaaagctggcggaatattatttgcagataatttagat
gatgcaaacaaaaaaattgaatcattgattggaaacacagtaaaaggagaactcgttgaa
aaagtactccttgatgaacaaattaaaattgcaaaagaatactatgttggcgttgttgtt
aacaggaacgaaaaaaacaatgttgtcatattttcaacagaaggtggagtagatattgaa
gaagtggcttcaaaaactcccgaaaaaataataaaattaccgttagaatctggaaaagaa
tttttaccataccttgcaagagaaatgctcaaaaaagcaggcattccgagtgcagaaatt
ccaaaagttgcggatgttttatgcaaagtttacaaagcattcaaaaacatggatggaatt
ttagctgaaataaacccgttggtatttaccgaagatggaaaaatcattgctgctgatgca
gttttgaatattgatgacgatgcgtactttagacataaatacgataaatttgaagaattt
aaaaaacaggaaaaatccgaatttgcatatgttgaacttgatggggacattgcagttatt
ggaaacggtgcaggactcacccttgcaagcatggacattgtaaaagagttcggcggagaa
cctgcatgtttcttagatgttggtggcggttccaatagagaaactgtaaaaaaagcactt
ttaaaagcaacttcaagaaaaaatgttaaaggagcgtttatcaacattcttggtggaatt
acaagatgcgatgaagtttcacttggaattgtagatgttttaaaagaaaatcctaacctc
aagtttgcagttaggatgatggggactaacgaagaaaaaggaagaaaaattctatctgaa
aatggagtaagtttcgaaaattcaatggaaggggctgcaagagcacttactgaattaata
aacagttaa

DBGET integrated database retrieval system