KEGG   Methanococcus maripaludis C5: MmarC5_0754
Entry
MmarC5_0754       CDS       T00491                                 

Definition
(GenBank) ATP phosphoribosyltransferase (homohexameric)
  KO
K00765  ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
mmq  Methanococcus maripaludis C5
Pathway
mmq00340  Histidine metabolism
mmq01100  Metabolic pathways
mmq01110  Biosynthesis of secondary metabolites
mmq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    MmarC5_0754
Enzymes [BR:mmq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.17  ATP phosphoribosyltransferase
     MmarC5_0754
SSDB
Motif
Pfam: HisG HisG_C Methyltransf_18
Other DBs
NCBI-ProteinID: ABO35064
UniProt: A4FXY0
Position
complement(722314..723180)
AA seq 288 aa
MILLALPNKGRISKPVNEILEKAGLKISVHGRSLFAQTVDPEIKVMFARAKDIPEFVRDG
VADVGVTGYDLMLERDTEEELEMLLDFKFGNARLVIAAPENSTVNSIEDVKDGMKIATEF
PGLTKRYLEKKGLNLEIIELSGATEIAPFIGVSDLICDLTSTGTTLQLNRLKEVENVVSS
TTRLVANKKSMDDPEKSAKINQVLSGIKSVLYAQSKRLIMMNAPKDKVSEITSIIPGMGG
PTVSEILSNDKMLAINAVIDENKVFETVTNLERLGARDILVVPIERIL
NT seq 867 nt   +upstreamnt  +downstreamnt
ttgattttacttgcattgccaaacaaaggaagaatttcaaaacctgtaaacgaaattttg
gaaaaagcaggtttaaagataagcgtacacgggagaagcctttttgcacaaactgttgac
ccagaaataaaagtgatgtttgcaagagcaaaagacattcctgaatttgtgagggatggt
gttgctgacgttggagttactggatacgatttaatgcttgagcgagatactgaagaagaa
cttgaaatgcttttagattttaagtttggaaatgcgagacttgtaattgcagctcctgaa
aattcaaccgtaaattctattgaagacgtaaaagatggaatgaaaattgcaacagagttt
ccaggccttacaaaaagatatttggaaaaaaaaggattgaatttagaaattattgaatta
agcggcgcaacagaaattgctccatttatcggtgtttctgatttaatttgtgatttaact
tcaactggaacaacacttcaattaaataggttaaaagaagtagaaaatgtagtttcatca
acaacaaggcttgtcgcaaacaaaaaaagtatggatgacccagaaaaaagtgcaaaaata
aaccaagttctttcaggaattaaaagtgtactctacgcacaaagcaaaagattgataatg
atgaacgctccaaaagacaaagtttcagaaattacatcaataattcctggaatgggcggt
ccaactgtatctgagattctttcaaatgataaaatgcttgcaattaatgcagtaattgat
gaaaataaggtctttgaaacagtcactaatctcgaaagactcggtgcaagagatattttg
gtcgttccaatagaaagaatactttaa

DBGET integrated database retrieval system