KEGG   Methanococcus maripaludis C5: MmarC5_0965
Entry
MmarC5_0965       CDS       T00491                                 

Definition
(GenBank) LSU ribosomal protein L24E
  KO
K02896  large subunit ribosomal protein L24e
Organism
mmq  Methanococcus maripaludis C5
Pathway
mmq03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mmq00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MmarC5_0965
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmq03011]
    MmarC5_0965
Ribosome [BR:mmq03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    MmarC5_0965
  Archaea
    MmarC5_0965
SSDB
Motif
Pfam: Ribosomal_L24e zf-FCS Ta0938 YacG YHS
Other DBs
NCBI-ProteinID: ABO35271
UniProt: A4FYI7
Position
936974..937162
AA seq 62 aa
MEWKTCSFCEGTIEPGCGKKYVKKDGSVMHFCSSKCEKNFKLGRVGRKLKWTNTFKRINR
GQ
NT seq 189 nt   +upstreamnt  +downstreamnt
atggaatggaaaacatgtagcttttgtgaaggcacaattgaacctggatgcggaaaaaaa
tacgttaaaaaagacggttcagttatgcacttctgttcatcaaagtgtgaaaagaacttc
aaactcggaagagttggaaggaaattaaaatggactaacactttcaaaagaattaacaga
ggacaataa

DBGET integrated database retrieval system