KEGG   Methanococcus maripaludis C5: MmarC5_1246Help
Entry
MmarC5_1246       CDS       T00491                                 

Definition
(GenBank) phosphoribosylamine--glycine ligase
  KO
K01945  phosphoribosylamine---glycine ligase [EC:6.3.4.13]
Organism
mmq  Methanococcus maripaludis C5
Pathway
mmq00230  Purine metabolism
mmq01100  Metabolic pathways
mmq01110  Biosynthesis of secondary metabolites
mmq01130  Biosynthesis of antibiotics
Module
mmq_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:mmq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    MmarC5_1246
Enzymes [BR:mmq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.13  phosphoribosylamine---glycine ligase
     MmarC5_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GARS_A GARS_N GARS_C ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ABO35544
UniProt: A4FZB0
Position
1190735..1192069
Genome map
AA seq 444 aa AA seqDB search
MKVLLIGGGAREHAIAMALKKNELVELYTLMKNKNPGIYAISDEVSFNSETDVPAIKEFA
EKIKPELAVIGPEAPLGVGAADLLIEMGIPTVGPKKLPAQIETSKEFMRNLFKKYEIDGS
LRYAAFNEYGNDLETFIDEMTSLGKDVVVKPAGLTGGKGVKVVGEQLKDNEEAKIYAKEV
FDKSIGGGNIIIEEKLVGVEFTLHGFVDGENIVFMPAVQDHPHAYNNDEGPITGGMGSYS
CPNHGLPFLSAEMLDRAEKIMEKTVSSINSEVGPYNGFLYGQFMLTADGPKIIEYNARFG
DPEAMNLLPILKTDFLDVCFAIAEGKLDKINLEFENKATVCKYVVPNGYPIDPVRNKELT
VDEKAIENADAILFYASINEKNGKLYITGSRSAAVVGISENIEEAEKIAQMAIENFKGEV
YYRSDIGTLGLIKKRIERVKQLAK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttttacttattggcggaggggctagagagcatgcaattgcaatggcccttaaa
aaaaacgaactcgtggaactctatactttgatgaaaaataaaaatccggggatatatgca
atctccgatgaagtatcatttaacagtgaaaccgatgttcctgcaataaaagagtttgcg
gaaaaaattaaacctgaacttgcagtaatcggtcctgaagcgccccttggagttggagct
gcagatttactcatagaaatgggtattccaacagttggtccaaaaaaacttcctgcacag
attgaaacaagcaaagaattcatgagaaacttatttaaaaaatatgaaatcgacggttct
ttaagatatgctgcatttaatgaatatggaaatgatcttgaaacatttatcgatgaaatg
acctcgttaggaaaagacgttgttgtaaaaccagcaggacttaccggcggaaaaggcgta
aaagtcgttggtgaacagttaaaagataatgaagaagctaaaatctacgcaaaagaagta
ttcgataaaagcattggtggcggaaacataattatcgaagaaaaacttgttggtgttgaa
tttacacttcacggatttgtagatggcgaaaatatcgtattcatgcctgctgttcaagac
caccctcatgcatacaacaatgatgaaggcccaatcacaggaggcatgggttcgtactcc
tgtccaaaccatggattaccatttttatctgctgaaatgcttgatagggcagaaaaaatt
atggaaaaaactgtcagttcaatcaattcagaagttggcccatataatggatttttatac
ggtcaattcatgttaactgctgatggtccaaaaattattgaatataacgcgagatttgga
gatcctgaagccatgaacttacttccaatattaaaaacagactttttggatgtttgtttc
gcaattgccgaaggaaaacttgacaaaataaaccttgaatttgaaaacaaagcaactgtt
tgtaaatacgtcgtaccaaatggttacccgatagacccagtaagaaacaaagaattgact
gttgacgaaaaagcaattgaaaatgcagatgcaatattgttctacgcttcaattaacgaa
aaaaatggaaaattatacattactggctcaagaagtgccgcggttgttggaatttcagaa
aatattgaagaagctgaaaaaatcgctcaaatggcaattgaaaactttaaaggcgaagta
tactacagaagtgacattggtacccttggtttgattaaaaaaaggatagaaagagtaaaa
cagcttgctaaataa

DBGET integrated database retrieval system