KEGG   Methanococcus maripaludis C5: MmarC5_1346
Entry
MmarC5_1346       CDS       T00491                                 

Definition
(GenBank) AMP phosphorylase
  KO
K18931  AMP phosphorylase [EC:2.4.2.57]
Organism
mmq  Methanococcus maripaludis C5
Brite
KEGG Orthology (KO) [BR:mmq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MmarC5_1346
Enzymes [BR:mmq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     MmarC5_1346
SSDB
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N Mucin_bdg Biotin_lipoyl_2 Ribosomal_S3Ae DUF2254
Other DBs
NCBI-ProteinID: ABO35644
UniProt: A4FZL0
Position
complement(1290720..1292237)
AA seq 505 aa
MLFLNAKFIDLDLGENAVIVNEEDLKGTSYYPQDRVLIESHAGSVIGNIYSTKTMVNKGE
VGMLVSELAEISISEGEEVKLRHAEKPESIPFIKKKMDGQVLNPHEIRTIIDEIVSKKLS
NIELSAFVSSTYINGMNMDEISEMTKRIAETGDMIAWEKSLVVDIHSIGGVPGNKYALLS
IPILAAAGITVPKTSSRAITSPAGTADVMEVLTNVELKEEEIKRIVKTTNGCLAWGGGVN
LAPADDIIINVERPVSIDPQPQLLASVMAKKIATGIKYTVIDIPVGKGVKIKNEAEGAKL
ARKFIELGESLNIKVECVLTYGGQPLGRAIGPALEAREAIEALQDPKNAPKSLIEKALSL
AGILLELGGAAQIGEGQNLAWEILESGKALEKFNQIITEQGGTPKKPEEIELGDYVEEIL
APIDGYITDISNTAITNVVKEAGAPRDKKAGILLNSKIGNKVKQGDVLYTIYSGSEERLV
SAINLARRVYPVKVEGMLIERISKF
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgctatttttaaacgcaaaattcatagaccttgatctaggtgaaaatgcggtaattgtc
aacgaagaggacttaaaaggaacttcgtactatccgcaagatagggtattgattgagtca
cacgcaggttccgtcattggaaacatttattccacaaaaactatggttaacaaaggcgaa
gttggaatgcttgttagtgaacttgcagaaatttccatttcagaaggggaagaagtaaaa
ttaagacacgcagaaaaacctgaatcaattccatttataaaaaagaagatggatggccag
gttttaaatccgcatgaaataagaacgataattgatgaaattgtatctaaaaaactctca
aacattgaattatctgcttttgtttcgtctacgtacataaatggaatgaatatggatgaa
ataagcgaaatgaccaagagaatcgcagaaactggggacatgattgcttgggaaaagagt
ttagttgtggatattcacagcattggtggagttcctggaaataagtacgccttactttca
atcccgatacttgcagcagcaggaattactgttccaaaaacgtcatcaagagcaataact
tcacctgctggaaccgcagatgtaatggaagtgctcacaaatgttgaattgaaagaagaa
gagattaaaagaatagtaaaaactacaaatggatgtcttgcatggggtggaggcgtaaat
ctagctcctgcagatgatataattataaatgtagaacggccggtttcaatagaccctcaa
ccacagcttcttgcaagtgttatggcaaaaaagattgcaacaggaattaaatatactgta
attgatattcccgttggaaaaggggtaaaaattaaaaatgaagcagaaggggcaaaatta
gcaaggaaatttattgaacttggggaatcgctcaatattaaggtggaatgtgtgttaact
tacggtgggcagccacttgggagggcaattggacctgcactcgaagcaagagaagcaatc
gaagcacttcaagatccaaaaaatgctccaaaaagtttaattgaaaaggcactatctctt
gcaggaattcttcttgaactcggaggggctgcacagattggggaaggtcaaaatttagca
tgggaaattttagaatccggaaaagcacttgaaaaatttaatcagattataactgaacag
ggtggaactccgaaaaaacccgaagaaatagaacttggagattatgttgaagaaattctt
gcgccaattgatgggtatattacagatataagtaacactgcaattacaaacgtggttaaa
gaagctggagctccaagggataaaaaagcaggaattttattgaattcaaagattggaaat
aaagtaaaacagggagatgttttatatacaatctattccggatcagaagaaaggcttgtt
tcagcaataaatcttgcaagaagagtttatcctgtaaaggttgaaggaatgcttattgag
agaataagcaaattctaa

DBGET integrated database retrieval system