KEGG   Methanococcus maripaludis C5: MmarC5_1357Help
Entry
MmarC5_1357       CDS       T00491                                 

Definition
(GenBank) fructose-bisphosphate aldolase / D-fructose 1,6-bisphosphatase
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mmq  Methanococcus maripaludis C5
Pathway
mmq00010  Glycolysis / Gluconeogenesis
mmq00030  Pentose phosphate pathway
mmq00051  Fructose and mannose metabolism
mmq00680  Methane metabolism
mmq01100  Metabolic pathways
mmq01110  Biosynthesis of secondary metabolites
mmq01120  Microbial metabolism in diverse environments
mmq01130  Biosynthesis of antibiotics
mmq01200  Carbon metabolism
mmq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC5_1357
   00030 Pentose phosphate pathway
    MmarC5_1357
   00051 Fructose and mannose metabolism
    MmarC5_1357
  Energy metabolism
   00680 Methane metabolism
    MmarC5_1357
Enzymes [BR:mmq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     MmarC5_1357
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MmarC5_1357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: ABO35655
UniProt: A4FZM1
Position
complement(1304530..1305681)
Genome map
AA seq 383 aa AA seqDB search
MEEKVTLSVIKADVGGLCGHTLAPEELLDAAEYVLENALDEILTDYYVTNCGDDIDMIMT
HDKGTDNEEVHKLAWDALEAATDVAKELKLYGAGQDLLSTSFSGNVKGLGPGCAEMEFVE
RPSEPVVVFCCDKTDPAAFNLPFYRMFSDPFSTAGLVYDPSMTTGFRYEVLDVMEHKKVF
METPEETYSLLALIGNTEKYAVKRVYRRKDNEIAAVCSSEKLNMIAGEYVGKDDPVAIVR
AQSGFPAVGEVLEGFANPHLVAGWMRGCHFGPIMPVGEEDAMPARFDGPARVMALGFQLS
HGRLVGPNDLFADKSFDKAREKALDMAEMMRSMGPFMPHRLPESMMEYTSVPKVLAQLKD
RFIDIEDKCDCKLDEIRERGDME
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaagtaactctaagtgttattaaggcagacgttggcgggctctgcggacac
acattagctccagaagaattattggatgctgcagaatacgttttagaaaatgcactcgat
gaaattttaactgattattatgttacaaactgtggtgatgatattgacatgatcatgacc
cacgacaaaggaacagacaacgaagaagtacacaaacttgcatgggatgctcttgaagca
gcaaccgatgttgcaaaagagttaaaattatatggtgcaggtcaagacttactttcaact
tcattttcaggaaacgttaaaggactcggcccaggatgcgctgaaatggaatttgttgaa
agaccaagtgaaccagttgtagtattctgctgtgacaaaacagaccctgcagcgttcaat
ttaccattttacaggatgttttcagacccattcagcactgcaggcttagtatacgatcca
tcaatgacaacagggttcagatacgaagttttagatgttatggaacacaaaaaagttttc
atggaaacccctgaagaaacatactcattacttgcattaattggaaacactgaaaaatac
gctgtaaaaagagtttacagaagaaaagacaatgaaattgcagcagtatgttcatcagaa
aaattaaacatgattgcaggagaatacgttggaaaggatgatcctgtagcaatcgtaaga
gctcaaagtggattccctgcggtaggggaagtattagaaggatttgcaaacccacacctc
gttgcaggatggatgaggggatgccactttggacctatcatgcctgttggtgaagaagat
gcaatgcctgcaagatttgacggacctgcaagagttatggctttaggattccagttatca
cacggaagattagttggaccaaacgacctcttcgcagacaaatcattcgataaagcaaga
gaaaaagcactcgatatggctgaaatgatgagatcaatgggtccattcatgccacacaga
ttgcctgaatcaatgatggaatacacatcagttccaaaagttttagcacagttaaaagac
agattcatcgatatcgaagacaaatgcgactgcaaactcgatgaaataagagaaagagga
gacatggaataa

DBGET integrated database retrieval system