KEGG   Methanococcus maripaludis C5: MmarC5_1468Help
Entry
MmarC5_1468       CDS       T00491                                 

Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
mmq  Methanococcus maripaludis C5
Pathway
mmq00860  Porphyrin and chlorophyll metabolism
mmq01100  Metabolic pathways
mmq01110  Biosynthesis of secondary metabolites
mmq01120  Microbial metabolism in diverse environments
Module
mmq_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mmq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MmarC5_1468
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmq01007]
    MmarC5_1468
Enzymes [BR:mmq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     MmarC5_1468
Amino acid related enzymes [BR:mmq01007]
 Aminotransferase (transaminase)
  Class III
   MmarC5_1468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Ligase_CoA
Motif
Other DBs
NCBI-ProteinID: ABO35765
UniProt: A4FZY1
Position
1403870..1405153
Genome map
AA seq 427 aa AA seqDB search
MELNLKMDRSKELFEESKKYLVGGVNSPVRSFKPFPFFVKSAKDCFLYDEDGNEFIDYCL
AYGPMVLGHANENILNAVKSQMDLGTAYGVPSEKEITLAKEVINRIPCAEMVRFVNSGTE
ATMGAIRLARGVTGRDKIIKFEGAFHGAHDYVLVKTGSGALTHGAPNSPGIPEDTTKNTL
LIPFNDEDAVRKVISENKDEIACIILEPVMGNVGCILPQDGYLQFLREITEENGILLIFD
EVITGFRLSKGGAQEYFGIKSDLATIGKILGGGFPIGAITGKKEYMEQFSPSGQIYQAGT
FNGNPVSVTAGIETLKNLDDKFYKETTKKADILSNFLRETAEKYNVSTKVYNVASIFQIY
FNEKEVVTYEDAKSSDTEKFMRYFYTLLENGVFVAPSQFECCFTSIKHNDEVLEKTMNAI
DIAMKKL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtggaattaaatctcaaaatggatagatcaaaagaactatttgaagaatcgaaaaaatac
cttgttgggggagtaaatagccctgtaaggtcatttaagccatttccattttttgtaaaa
tctgcaaaagactgtttcttgtacgatgaagacggaaacgaatttattgattactgttta
gcatacgggccgatggttttgggtcatgcaaacgaaaacatattaaatgctgtaaaatcc
caaatggatttgggaactgcttacggagttccaagcgaaaaagaaattacgcttgcaaaa
gaagtaataaatagaatcccttgcgcagaaatggttagatttgtaaattctggaacggaa
gctaccatgggcgcaataaggcttgcaagaggtgttactggaagagataaaatcatcaag
tttgaaggtgcgttccacggtgctcacgactacgtgcttgtaaaaacaggtagtggtgct
ttaacacacggagctccaaattcaccaggaattccagaagacactacaaaaaacacgctt
ttaattccatttaacgatgaagatgcggtaagaaaagtaatctctgaaaacaaggatgaa
atcgcatgtatcatccttgaacctgtaatgggaaatgttggttgtattttaccacaggac
ggatatttacagtttttaagggaaatcactgaagaaaatggaatacttctaatattcgat
gaagttattactggtttcaggctttcaaaaggtggtgctcaggaatactttggaataaaa
tcagaccttgcaactatcggtaaaattcttggtggtggatttccaattggtgcaataact
ggtaaaaaagaatatatggaacagttttcaccaagtggacagatttatcaagcaggtacc
tttaacggaaacccggtttcagttaccgccggaattgaaacacttaaaaatcttgatgat
aaattttacaaggaaacaactaaaaaagcagatattttatccaatttcttaagagaaact
gctgaaaaatacaatgtttctacaaaagtttacaatgtagcttcaatattccagatttac
ttcaatgaaaaagaagtagtaacttacgaagatgcaaaatcaagcgatactgaaaaattc
atgagatatttctacacgcttttggaaaatggcgtatttgtagctccttcccaatttgaa
tgctgctttacatcgataaaacacaacgatgaagttttagaaaaaactatgaatgcaatt
gatattgcaatgaaaaaattgtaa

DBGET integrated database retrieval system