KEGG   Maricaulis maris: Mmar10_0194
Entry
Mmar10_0194       CDS       T00394                                 

Definition
(GenBank) protein-S-isoprenylcysteine methyltransferase
Organism
mmr  Maricaulis maris
SSDB
Motif
Pfam: PEMT ICMT NnrU DUF1295 ERG4_ERG24
Other DBs
NCBI-ProteinID: ABI64490
UniProt: Q0AT97
Position
208561..209205
AA seq 214 aa
MTQSDYGLWSLVALNSAVFILFAASFSRPRSWRDWRSFGAFSAFLIALFTEMYGFPLTLY
ALSGWLQSAYPEINWFSHEAGHLPEMLFGWQGNPHFGPFHLISALFIGGGFWLIASAWRV
LYTAQSSGELAQTGPYARVRHPQYIGFVLILTGFLFQWPTLLTLVMYPVLIWMYVRLALI
EEQETRAAHGEDFDRYAARVPRFVPSLSTPTRPS
NT seq 645 nt   +upstreamnt  +downstreamnt
atgacgcagtcggattatggtctttggtctctggtcgcgctgaattcagccgtttttatt
ttgttcgctgcgagcttctcgaggccgcgctcttggcgcgattggcggtcttttggagca
tttagcgcctttttgatcgcgcttttcaccgaaatgtatggctttcccctcacgctttac
gccctgtctggttggcttcaatcggcctatcccgagatcaattggttcagtcatgaagcg
ggccatctacccgaaatgctctttgggtggcaaggcaatccgcatttcggtccctttcac
ctcataagcgccctatttattggtggcggcttttggctgatcgcgagcgcctggcgtgtc
ctttacaccgctcaatcgagtggtgaattagcgcaaactggcccctacgctcgtgttcgc
catcctcaatacattggcttcgtgctcattttgaccggctttctctttcaatggccaaca
ctgctcacactggtcatgtaccctgtcctcatatggatgtacgttcggcttgccttgatt
gaagagcaagaaacccgagccgcgcacggtgaggattttgatcgctacgcggcgcgtgtt
cctcggtttgttccatccctgtcgacgccaaccaggccgtcatga

DBGET integrated database retrieval system