KEGG   Maricaulis maris: Mmar10_0247
Entry
Mmar10_0247       CDS       T00394                                 
Name
(GenBank) Glucan endo-1,3-beta-D-glucosidase
Organism
mmr  Maricaulis maris
SSDB
Motif
Pfam: Glyco_hydro_16 SKN1_KRE6_Sbg1
Other DBs
NCBI-ProteinID: ABI64540
UniProt: Q0AT47
Position
265344..266330
AA seq 328 aa
MTMTNGLARGLVALGLLALSSPVVSAQEAPGPADSPWRLVWADEFDGDSIDPERWNLEQD
CWGGGNAERQCYTAFEENARIEDGKLVIEARLGEARGPALPAHLRAGASAEERQATTAQP
FTSARLNTRDKGDWRYGRIEVRAQLPEGQGSWPAIWMLPTDEVYGGWAASGEIDILEAVN
LGEPCRECRGDVENRVFGTLHYGGEWPENTYQNRETTLPPSENGEQDFHVFAVEWSEGRI
EWFLDGESYGYLTQRRWRSSSEAARGRPFAPFDQRFHLILNLAVGGHLAEGRNVGGVRVE
AFPQQFIVDWVRVYDCPQDLETAQACVN
NT seq 987 nt   +upstreamnt  +downstreamnt
atgacgatgaccaatggtctggcccggggcttggtcgccctgggcctcctcgccctttct
tcaccggtcgtttcagctcaggaggcaccgggcccggcggacagtccctggcgcttggtc
tgggcggacgagttcgatggcgattcaatcgatcccgagcgctggaatctggagcaggat
tgctggggcggcggcaatgccgaacgtcaatgctataccgcctttgaagagaacgcccgg
attgaggatggcaagcttgtcatcgaggcccgtctgggcgaagcgaggggcccggctttg
ccggcacatcttcgtgccggtgcctccgcggaggagcggcaggcgacaacagcacaacca
ttcacctcggcgcgattgaatacacgcgacaagggcgattggcgctacggacggatcgaa
gtccgcgcgcaattgcccgaggggcagggaagctggccagcgatctggatgttgccgacc
gatgaggtctatggcggctgggcggcgtcaggcgagatcgacatccttgaggctgtaaat
ctcggtgagccatgcagggaatgtcggggcgacgttgaaaaccgggtgttcgggacgctt
cactacgggggtgagtggccggagaatacctaccagaaccgtgaaaccacgcttcctccc
agcgaaaatggcgaacaggacttccatgtcttcgccgtcgagtggtccgaaggccggatc
gagtggtttcttgacggagagtcctacggatatctgacacaacgccgctggcggtcatcg
tcggaggcggcccgagggcgaccttttgctcccttcgatcaacgattccatttgatcctc
aatctcgcagtgggtgggcatctggccgaggggcgcaatgttggcggcgtgcgggtcgag
gcctttccccagcaattcatcgtcgattgggtgcgggtctacgattgcccgcaggacctg
gaaacagcgcaagcctgcgtcaattga

DBGET integrated database retrieval system