KEGG   Maricaulis maris: Mmar10_0491Help
Entry
Mmar10_0491       CDS       T00394                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
mmr  Maricaulis maris
Brite
KEGG Orthology (KO) [BR:mmr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Mmar10_0491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 LTD
Motif
Other DBs
NCBI-ProteinID: ABI64784
UniProt: Q0ASF3
Position
complement(578461..578853)
Genome map
AA seq 130 aa AA seqDB search
MYEHESCGVRISVSPDYLEDESTPEEGRFVWAYTIEIENTGKQPVQLIARKWMITDANGR
TEHVQGMGVIGEQPVIEPGGRFRYTSGAPLPTPSGFMSGSYEMRRGDGESFAATIPDFSL
DRPSDRLWLH
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtatgagcacgaaagctgcggcgtgcggatcagtgtcagtcctgactatctggaagac
gagagcacgccggaagaaggccgctttgtctgggcctatacgatcgagatcgagaacacc
gggaaacagcctgtacagctgatcgcccgcaaatggatgatcaccgacgccaatgggcgc
accgagcatgtgcaaggcatgggcgtgatcggcgagcagccggtgatcgagccaggaggc
cgcttccgctacacatccggcgcgcctctcccgacgccgtcaggtttcatgagcggcagt
tacgaaatgcgacgcggcgatggtgaaagtttcgcggcaaccattcccgatttctcgctg
gatcggccgtccgaccgtttgtggctgcactga

DBGET integrated database retrieval system