KEGG   Maricaulis maris: Mmar10_1039Help
Entry
Mmar10_1039       CDS       T00394                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent enzyme, beta subunit
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mmr  Maricaulis maris
Pathway
mmr00260  Glycine, serine and threonine metabolism
mmr00750  Vitamin B6 metabolism
mmr01100  Metabolic pathways
mmr01110  Biosynthesis of secondary metabolites
mmr01120  Microbial metabolism in diverse environments
mmr01230  Biosynthesis of amino acids
Module
mmr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmar10_1039
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mmar10_1039
Enzymes [BR:mmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mmar10_1039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABI65332
UniProt: Q0AQV5
Position
complement(1133046..1134272)
Genome map
AA seq 408 aa AA seqDB search
MTQAPANYFTHLECSETGDRYEADQPHNLSKAGKPLLARYDLDAMKAGIDRDTIWSRDGG
FWKWRELLPVADDAHVCALGEIDTPLIDIPATAKVSGATGKVWVKDEGRLPTGSFKARGL
ALAVAMAHQYGLTRLAMPTNGNAGAALSAYASRMGMESWCFAPEDTPEANLREMALQGAH
VFKVNGYIHHCGALVGAGKEKMGWFDVSTLKEPYRIEGKKTMGLELAAQLGWRVPDAIFY
PTGGGTGLIGMWKAFDEMEQLGWIGPERPKMFAVQAEGCAPIVKAYEDGTRLAEEWIDAQ
TAAMGIRVPKAIGDFLILDAVRESGGAALAVSEVAIEAARTRCAREDGLLLCPEGAATLA
AMEKAMGDGLLERDAECVLFNCGSGLKYAMPDGAKALDRHGDVDWGSL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagcccccgccaattacttcacccatctggagtgttcggaaaccggcgatcgc
tatgaggccgaccagccgcacaatctgtccaaggccggcaaaccgctgctggcgcgctat
gacctggacgcgatgaaggccggcattgatcgcgacaccatctggtcgcgtgatggcggt
ttctggaagtggcgcgagcttctgccggtagccgacgacgcccatgtctgtgccctgggc
gagattgatacgccgctcatcgacattcccgccacggccaaggtgtccggagcaacgggc
aaggtctgggtcaaggatgaaggccgcctgccgacgggcagtttcaaggcgcgcggtctc
gccctcgccgtcgccatggcccatcaatacggcctcacccggctggccatgccgaccaat
ggcaatgccggggccgcgctctcagcctatgccagccgcatgggcatggagagctggtgc
tttgcgccggaagacacgccggaagccaatctgcgcgaaatggcgctgcagggcgcccat
gtcttcaaggtcaatggctatatccatcattgcggcgctctcgtcggggccggcaaggag
aagatgggctggtttgatgtctcgaccctcaaggagccctaccggatcgaaggcaagaaa
acgatgggcctggaactcgccgcccagctgggctggcgcgtgcccgacgcgatcttctat
cccaccggcggcggcaccggcctgatcggcatgtggaaggctttcgacgagatggaacaa
ctcggctggatcggcccggaacgcccgaaaatgttcgccgtccaggcggaaggctgcgcc
cccatcgtcaaggcttacgaggacggcacccgcctcgccgaagaatggatcgacgcccag
accgccgccatgggcatccgcgtccccaaggcgatcggtgatttcctgatcctggacgcc
gtgcgggaaagcggcggcgccgcgctggctgtgtcggaagtcgcgatcgaagccgcccgc
acacgctgcgcacgcgaggacggactgctgctctgccccgagggtgcggcaaccctggcc
gctatggaaaaagcaatgggtgacggcctgctggagcgagatgccgagtgcgtgttgttc
aattgcgggtctggactgaaatacgcaatgccggatggggcgaaggcgctggatcggcat
ggcgatgtggattgggggagtctttag

DBGET integrated database retrieval system