KEGG   Maricaulis maris: Mmar10_2098Help
Entry
Mmar10_2098       CDS       T00394                                 

Definition
(GenBank) SSU ribosomal protein S6P modification protein
  KO
K05844  ribosomal protein S6--L-glutamate ligase [EC:6.3.2.-]
Organism
mmr  Maricaulis maris
Brite
KEGG Orthology (KO) [BR:mmr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmr03009]
    Mmar10_2098
Enzymes [BR:mmr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.-  
     Mmar10_2098
Ribosome biogenesis [BR:mmr03009]
 Prokaryotic Type
  ribosomal protein modification factors
   Mmar10_2098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK Rimk_N GSH-S_ATP ATP-grasp_3 ATPgrasp_ST ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ABI66390
UniProt: Q0AMU7
Position
complement(2283490..2284395)
Genome map
AA seq 301 aa AA seqDB search
MKLLMLARNPNLYSHRRLVEAAEARGHELDIYDTLKMYMNITSHRPEVRYQGRVLSGYDA
IIPRIGASITGYGMAVVRQFEMMGVWALNESVAIGRSRDKLRSLQLLSRAGLGLPVTAFA
HDTSMTDDVLDIAGGEPVVIKLLEGTQGVGVVLAETRRSAKSVIEAFRGAKVDILVQEFI
KEAGGADIRTIVVGGKVVAAMKRQGAEGDFRSNLHRGGSASKIKLTPEERSTAVRAAKVM
GLNVAGVDMLRGNHGPLIMEVNSSPGLEGIEASTGVDVADKIIDFVEKTAVAGKTRTRGT
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgctcatgctggcccgcaatccgaacctctactcgcacaggagactcgttgaa
gcggctgaggcccggggccatgaactcgacatctatgatacgctgaagatgtacatgaac
atcacctcgcatcgccccgaagtgcgttatcagggccgtgttctgagtggttatgacgcg
atcatcccgcggatcggggcctcgatcaccggttacggcatggcggtggtccgccagttc
gagatgatgggcgtctgggcgctcaacgagtcggtcgccatcggccgctcgcgcgacaag
ctgcgctcgctgcaactcctgtcgcgcgccggcctcggcctgccggtgacggcctttgcc
cacgacacctcgatgaccgatgacgtgctcgacattgccggtggtgagccggtggtgatc
aagcttctggaaggcacgcaaggcgttggcgtggtactggcggaaacgcgccgttcggcc
aagtccgtgatcgaagccttccgcggcgccaaggtcgatatcctggtgcaggaattcatc
aaggaggccggcggcgccgacatccgcaccatcgtggttggcggcaaggttgtcgcggcg
atgaagcgccagggtgccgagggcgatttccgctccaacctgcatcgcggcggctcggct
tcgaagatcaagctgaccccggaagaacgctcgaccgccgtccgtgccgccaaggtgatg
gggctcaatgtcgccggtgtcgacatgctgcgcggcaatcacggcccgttgatcatggaa
gtgaattcctcgccgggcctggaaggcatcgaagcctcgaccggtgtcgatgtggccgac
aagatcatcgatttcgtggaaaaaacggcggtggccggcaagaccaggacacgtggtacc
ggatga

DBGET integrated database retrieval system