KEGG   Maricaulis maris: Mmar10_2491Help
Entry
Mmar10_2491       CDS       T00394                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmr  Maricaulis maris
Pathway
mmr00040  Pentose and glucuronate interconversions
mmr00052  Galactose metabolism
mmr00500  Starch and sucrose metabolism
mmr00520  Amino sugar and nucleotide sugar metabolism
mmr01100  Metabolic pathways
mmr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mmar10_2491
   00052 Galactose metabolism
    Mmar10_2491
   00500 Starch and sucrose metabolism
    Mmar10_2491
   00520 Amino sugar and nucleotide sugar metabolism
    Mmar10_2491
Enzymes [BR:mmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mmar10_2491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABI66777
UniProt: Q0ALR6
Position
2706983..2707855
Genome map
AA seq 290 aa AA seqDB search
MTRVRKAVLPVAGFGTRVLPATKSIPKEMLPVFDRPAIQYVVDEAIAAGIEHFVFVTGRN
KAAIEDHFDTAYELEASLRMKGEEGLLAEITQSKPTPGSMSFVRQQAPLGLGHAIWCARD
IIGDDPFAILLPDVLVQAEPSCLAQMINVFDETGGNVIAVEQVPPAEVSKYGIIDPQSRD
GNRIRMRGMVEKPPVDAAPSNLSITGRYILQGSIFEYLADQAAGAGGEIQLTDAMARLME
TQDFHAVEYEGQSYDCGSKLGYLRATMAYARAHPSLGDGAQALIDEFSRT
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcgtccgcaaagctgtgctgccggttgccggctttggaacccgggttcttccc
gccaccaagtccatcccaaaggaaatgcttccagtcttcgaccgcccggcgatccagtat
gtcgtcgatgaagccattgctgccggcatcgagcacttcgtcttcgtgacgggtcgcaac
aaggctgcgatcgaggaccattttgacactgcctatgagctcgaggccagcttgagaatg
aaaggtgaggaaggcctccttgccgagataacccagtccaaacccactccaggctcgatg
agttttgtgcggcagcaggccccgctgggcctgggccatgcgatctggtgcgcccgcgac
atcatcggcgatgatccctttgccatcctgctgccggacgttctcgtccaggccgagccc
agctgcctcgcccagatgatcaatgtgttcgacgagaccggcggcaatgtgatcgcggtc
gaacaggtgccgcctgcggaagtcagcaaatacggaatcattgatccgcaatcgcgcgac
ggtaaccgcatccgaatgcgcggcatggtggaaaaaccgcccgttgatgctgccccgtcc
aatctctcgatcactggtcgctacatcctgcagggatcgattttcgaatacctggccgac
caggcagccggcgctggcggcgagatacaattgaccgacgccatggcgcgattgatggag
acccaggacttccatgccgtggagtatgaggggcagtcctatgactgcggcagcaaactc
ggctatctgcgcgcgaccatggcctacgcccgcgcccatcccagcctcggtgatggtgcc
caggccctgatcgatgaattcagccggacgtga

DBGET integrated database retrieval system