KEGG   Maricaulis maris: Mmar10_2663Help
Entry
Mmar10_2663       CDS       T00394                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mmr  Maricaulis maris
Pathway
mmr00071  Fatty acid degradation
mmr00072  Synthesis and degradation of ketone bodies
mmr00280  Valine, leucine and isoleucine degradation
mmr00310  Lysine degradation
mmr00362  Benzoate degradation
mmr00380  Tryptophan metabolism
mmr00620  Pyruvate metabolism
mmr00630  Glyoxylate and dicarboxylate metabolism
mmr00640  Propanoate metabolism
mmr00650  Butanoate metabolism
mmr00900  Terpenoid backbone biosynthesis
mmr01100  Metabolic pathways
mmr01110  Biosynthesis of secondary metabolites
mmr01120  Microbial metabolism in diverse environments
mmr01130  Biosynthesis of antibiotics
mmr01200  Carbon metabolism
mmr01212  Fatty acid metabolism
mmr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mmar10_2663
   00630 Glyoxylate and dicarboxylate metabolism
    Mmar10_2663
   00640 Propanoate metabolism
    Mmar10_2663
   00650 Butanoate metabolism
    Mmar10_2663
  Lipid metabolism
   00071 Fatty acid degradation
    Mmar10_2663
   00072 Synthesis and degradation of ketone bodies
    Mmar10_2663
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mmar10_2663
   00310 Lysine degradation
    Mmar10_2663
   00380 Tryptophan metabolism
    Mmar10_2663
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mmar10_2663
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mmar10_2663
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mmar10_2663
Enzymes [BR:mmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mmar10_2663
Exosome [BR:mmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mmar10_2663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Thiolase_N
Motif
Other DBs
NCBI-ProteinID: ABI66949
UniProt: Q0AL94
Position
complement(2907807..2908964)
Genome map
AA seq 385 aa AA seqDB search
MSLRNAACIVGAFEHPTRLAPDMTTPQLHAECAAGALADAGLSLTDVDGYFCATDAPGFG
PISMIDYLGLDIRHTDSTEMGGCTYIQHVAHAAQAIAMGKCSVALITLAGRPRSEAVQRF
RPGAPESAFEQWVGLTNHTSYGMCAARHMHEFGTTSEQLAWIKVAASHHAQHNPHAMLPK
VVTVEDVVTSPMIADPLHRLDCCVTTDGGGALVVVSPEIARTLNRPVISLLGAGEATKGP
SGGLGLDLTVSAAAKSGPRAFAEAGVTPSDIKYASIYDSFTITVLMQLEDLGFCAKGEGG
KFVADGNLISGTGKLPFNTDGGGLCNNHPMFRGGITKVIEAVRQLRGEAAPAVQVPNCDL
AVATGIGGSLGARHGAATIILERQS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcgtaacgccgcctgcatcgtcggtgcattcgaacatcccacccggctggcg
ccggacatgaccacgccgcagctgcatgctgaatgcgcggccggggcgctggctgatgcc
ggcctctcgctgacggacgttgatggctatttctgtgccaccgatgcgcccggcttcggg
ccgatctcgatgatcgactatcttggcctggacatccgccacactgattcaaccgagatg
ggtggctgtacctatatccagcatgtcgcccatgccgcgcaggcgatcgccatgggcaag
tgctcggtggcgctgatcaccctggccgggcggccgcgctcggaggcagtgcaacgcttc
cggcccggggcgccggaaagcgctttcgagcaatgggtcgggctgaccaatcacaccagc
tacggcatgtgtgctgcccgccacatgcatgaatttggcaccacgtcggaacagctggcc
tggatcaaggtcgctgcctcgcaccatgcccagcacaatccgcacgccatgctgcccaaa
gtggtgacggtcgaggatgttgtgaccagcccgatgatcgctgatccgttgcaccggctc
gattgctgcgtgacgacggatggtggtggcgccctcgtcgtggtttcgccggagattgcc
aggacgctcaaccgtccggtgatctccctgctgggagccggcgaggcgaccaagggcccg
tccggcggtttgggtctcgacctcacggtgtcggccgccgcaaagtcggggccgcgtgcc
tttgcggaggccggcgtcacgccgtccgacataaaatacgcctcaatctatgacagcttc
accatcaccgtgctgatgcagctggaagatctgggcttttgcgccaagggcgagggcggc
aagttcgtggccgacggcaatctcatctccggcaccggcaaactgcccttcaacaccgat
ggtggcgggctgtgcaacaaccatcccatgttccgaggcggcattaccaaggtgatcgaa
gcggtgcggcaattgcgcggcgaggcggcccctgccgtccaggtgcccaattgtgacctt
gccgtcgccaccggcattggcggctccctcggcgcccggcacggcgcggccaccatcatt
ctggagcgccagtcatga

DBGET integrated database retrieval system