KEGG   Maricaulis maris: Mmar10_2760Help
Entry
Mmar10_2760       CDS       T00394                                 

Definition
(GenBank) UDP-galactose 4-epimerase
  KO
K12448  UDP-arabinose 4-epimerase [EC:5.1.3.5]
Organism
mmr  Maricaulis maris
Pathway
mmr00520  Amino sugar and nucleotide sugar metabolism
mmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Mmar10_2760
Enzymes [BR:mmr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.5  UDP-arabinose 4-epimerase
     Mmar10_2760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind Polysacc_synt_2 3Beta_HSD NAD_binding_10 NAD_binding_4 NmrA KR
Motif
Other DBs
NCBI-ProteinID: ABI67044
UniProt: Q0AKZ9
Position
3040734..3041726
Genome map
AA seq 330 aa AA seqDB search
MNILVIGGAGFIGSHVCKAIAARGDLPIVFDNLSRGNAHAVQWGPLFKGDVRDAAALDLV
FGDYTPVAVMHFAANTEVEEGEQAPLAFWDNNVGGVIALLQAMRRAGCDRLVFSSTCATY
GMIEQFPLTEDRLQLPVNVYGRTKLAVEHMLADVSRTEGLRYAALRYFNAAGASPDGEIG
EEHKPETHLIPNALKAAAGLGGTMKVFGGDYDTPDGTCIRDYIHVMDLAAAHLAALDRLG
RYKGGVACNVGTGQGHSVRDVLEAVEAVTGRPVPYELHDRRPGDPPRLVADVTLSRDLLG
FQPVSSDLETIVRTAWNFHQARWQATVVSD
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcctggtaatcggcggggccggctttattggctcgcatgtctgcaaggcaatc
gcggctcggggtgatttgccgatcgtgtttgataatctctcgcgcggaaatgctcatgcc
gtgcagtgggggccgcttttcaaaggcgatgtccgtgatgcggcggcgctcgacttagtt
tttggtgactatacgcctgtcgccgttatgcactttgctgcaaatactgaggtcgaagag
ggtgagcaggcgcctctggccttttgggacaacaatgtgggcggtgtgatcgcgctgctt
caggccatgcgtcgcgcgggctgcgaccgattggtcttttcctctacttgcgcaacctac
ggcatgattgagcagtttcctctcaccgaagacaggctgcagttaccagtcaatgtttat
gggcgaaccaagttggcagttgaacacatgctggctgatgtcagccggacggagggcttg
cgctacgcagcgctgcgctatttcaatgccgcaggcgcgagcccagacggcgagatcggt
gaggagcacaagccggaaactcatctgatccctaatgccctaaaggccgccgcaggcctg
ggcggcaccatgaaggtgttcggtggtgactatgacacgccagacggaacatgcatccgc
gactacattcatgtcatggatctggctgcggcacatctagcagcgcttgatcgccttggc
aggtacaaggggggagttgcttgcaatgttggcacgggccaaggacattcggtgcgcgac
gtgctcgaagccgttgaggctgtgaccggcagacccgtaccgtacgagctccatgaccgc
cggcccggcgatccgccgcggctcgtcgcggatgtgacgttgtcccgggaccttctgggc
ttccagccggtaagctcggacttagaaacaatcgtacgcacggcctggaattttcaccaa
gccagatggcaagcgacggtcgtgtcagattaa

DBGET integrated database retrieval system