KEGG   Maricaulis maris: Mmar10_2816Help
Entry
Mmar10_2816       CDS       T00394                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mmr  Maricaulis maris
Pathway
mmr00020  Citrate cycle (TCA cycle)
mmr00310  Lysine degradation
mmr01100  Metabolic pathways
mmr01110  Biosynthesis of secondary metabolites
mmr01120  Microbial metabolism in diverse environments
mmr01130  Biosynthesis of antibiotics
mmr01200  Carbon metabolism
Module
mmr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mmar10_2816
  Amino acid metabolism
   00310 Lysine degradation
    Mmar10_2816
Enzymes [BR:mmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mmar10_2816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_D23 HlyD_3 GCV_H RnfC_N Peptidase_M23 YqfD
Motif
Other DBs
NCBI-ProteinID: ABI67097
UniProt: Q0AKU6
Position
complement(3101862..3103385)
Genome map
AA seq 507 aa AA seqDB search
MTDITVPQLGESVTEATVGSWMVKTGDAVSRDDVLVELETDKVAVEVRAEADGVMGEIFA
AEGDNVEIGAKLAVIEAAGSDAAAKSEPAEDSSDPAPMAAAEPDVKESKAAGSAETVEAT
VPQMGESVTEGTIGAWLVKAGDSVEIDQALVEIETDKVAVEVPSPVAGVVSELLVAEGDT
VAPGDAVARIGEGGAAQAAPSAESQPSEGSTDTKTMPSAARVIEENRLDAGAITGSGKDG
RITKGDALKAAAGAPAAPKAAPAAAAAPVAPRETGPREERVRMTRLRQTIAKRLKDAQNA
AAILTTYNEADMSAIMAARKAHQEAFVAKHGVKLGFMSFFVKACCHALKEVPAVNAEIDG
TDIIYKNYYDMGVAVGTDRGLVVPVVRDADQMTLAEIEKEIIRLGKRARDGKLSIDEMQG
ATFTISNGGVYGSLMSMPILNAPQSGILGMHKIQERPMAENGQVVIKPMMYLALSYDHRI
VDGKEAVTYLVRVKENLEDPQRMMFDL
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatcaccgtgccgcagctcggcgagagcgtcaccgaagccaccgtgggcagc
tggatggtcaagaccggcgacgcggtctcccgggatgatgtcctggttgagttggaaacc
gacaaggtcgctgttgaagtccgtgctgaagcggacggagtgatgggtgagattttcgcc
gccgaaggcgacaatgttgaaattggcgccaagctggctgtgatcgaagctgctggcagt
gatgcagcagccaagagcgaaccggctgaagacagcagtgatccggcaccgatggccgct
gcggaaccggacgtcaaagagtccaaagccgccggctcggctgagaccgtcgaagccacc
gtgccgcagatgggtgaaagcgtaaccgagggaacaatcggagcctggctcgtgaaagcc
ggtgactcggtggagatcgaccaggcgctggtcgagatcgaaaccgacaaggtggcggtt
gaagttccgtctcccgttgctggtgttgtctccgagctgttggtagccgagggcgacacg
gttgcgcctggcgatgcggtcgcccgcattggcgaggggggcgccgcccaagcagcgccg
agcgctgaaagccagccgtccgagggctcgacagacacaaagaccatgccgtctgccgcc
cgggtcatcgaagagaacaggctggatgctggtgcgatcaccggatcgggcaaggacggc
cgcattaccaagggtgacgcattgaaggctgctgctggtgcgccggctgcgccaaaagcc
gctccggcggctgccgccgcgccggtcgctccccgcgagacgggaccacgcgaagaacgg
gtccgtatgacccgcctgcgccagacaatcgccaagcggctcaaggatgcccagaacgcc
gctgccatcctgaccacctataatgaagccgacatgtcggcgatcatggcggcccgaaag
gcgcaccaggaggccttcgtggccaagcatggcgtcaagctgggcttcatgagcttcttc
gtgaaggcttgttgccacgcgctgaaggaagtgccggcggtcaatgccgaaatcgacggc
accgacatcatctacaagaattactatgacatgggtgtcgcagtcggcaccgatcgcggc
ctggtcgtaccggtcgtgcgtgacgccgaccagatgaccctggcggagatcgagaaagag
atcatccggctgggcaagcgggcgcgtgacggcaagctttcgatcgacgaaatgcagggc
gcgaccttcaccatctcgaatggcggcgtgtacggctcgctgatgtcgatgccgatcctc
aatgcgcctcagtcaggcattctgggtatgcacaagatccaggaacgcccgatggccgag
aatggtcaggttgtcatcaaacccatgatgtaccttgctctttcgtacgatcaccgaatt
gtcgacggcaaggaagcggttacctacctcgtgcgggtaaaggaaaacctggaagatcca
caacgcatgatgttcgacctgtag

DBGET integrated database retrieval system