KEGG   Janthinobacterium sp. Marseille: mma_0232Help
Entry
mma_0232          CDS       T00561                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
mms00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mms01100  Metabolic pathways
mms01110  Biosynthesis of secondary metabolites
mms01130  Biosynthesis of antibiotics
mms01230  Biosynthesis of amino acids
Module
mms_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    mma_0232 (trpC)
Enzymes [BR:mms01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     mma_0232 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABR88848
UniProt: A6SUH5
Position
complement(250912..251712)
Genome map
AA seq 266 aa AA seqDB search
MSDILNKILDVKADEVAAAKKYRSLASLRDEVEGNKEARAAIRGFEASLRAKIAAGQAGI
IAEIKKASPSKGVIRPDFHPADIAVSYEKNGAACLSVLTDVQFFQGAPEYLKQARTACAL
PALRKDFMIDPYQLYEARSWGADCILLIVAALDHGLMAELEACAHELGMNVLVEVHNAEE
LTAALKLKTSLLGVNNRNLRTFETSLQTTLDLLPRISPDKLVITESAIVTPDDVKKMRDA
DVHAFLVGEAFMRAPDPGVELGRLFN
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatatcctcaataaaatcctcgacgtcaaagctgatgaagtcgctgctgcgaaa
aaatatcgcagcctggccagcctgcgtgacgaagtggaaggcaataaagaagcgcgtgca
gctattcgcggcttcgaagccagcctgcgcgcaaagattgccgcaggacaggccggcatc
atcgccgaaatcaaaaaggcttcgccatccaaaggcgtgattcgccccgacttccatccg
gccgatatcgctgtcagctatgaaaagaatggcgcggcctgtttatcggtgctgaccgac
gtacagtttttccagggtgcgccggaatacctgaagcaggcgcgtaccgcctgcgccttg
cccgcattgcgcaaggatttcatgatcgacccgtatcaattgtatgaagcacgctcctgg
ggtgccgattgcatcttgctgatcgtcgcggcactggaccatggcttgatggcagagctc
gaagcctgcgcgcatgaattgggtatgaatgttttggtggaagtacacaatgcggaagaa
ttgacggctgcattgaaactaaaaaccagcctgctcggtgtcaacaaccgcaatctgcgc
accttcgagacttcgctgcaaaccacgctggatttgctgccgcgcatttcgccggacaaa
ctggtcatcaccgaatcggcgattgttacgcctgatgatgtgaagaaaatgcgtgatgct
gatgttcacgccttcctggtcggcgaagcctttatgcgtgcgccggatccgggcgtcgaa
ctgggtcgcctgtttaactaa

DBGET integrated database retrieval system