KEGG   Janthinobacterium sp. Marseille: mma_0269Help
Entry
mma_0269          CDS       T00561                                 

Definition
(GenBank) Gluconolactonase
  KO
K14274  xylonolactonase [EC:3.1.1.-]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
mms00040  Pentose and glucuronate interconversions
mms01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    mma_0269
Enzymes [BR:mms01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     mma_0269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL Arylesterase Phytase-like
Motif
Other DBs
NCBI-ProteinID: ABR89799
UniProt: A6SUL2
Position
complement(302703..303593)
Genome map
AA seq 296 aa AA seqDB search
MSMQNIQPILPVRMQLGECPLWHPEEAALYWIDIDGRAVHRFIPANDVHQQWDMPSEPGC
IALNAGSGLLVALRSGLALLDTTSGQLTQIADAPYDPATTRFNDGRCDAAGRLWTGSIYE
PRDHANAALYCVEHGEIRDSDKRATVSNGVAFSPDNRTMYHADTTTHRIFAYEFDIGSAT
LGEGRVLKQFSTDKQNNYGGRPDGAAVDSEGNYWCAMYEGGRILRLSPAGDILSELALPV
RCPTMMAFGGDDLRTLYITSVSKNRPAAELEQYPLSGCVLSLRVDVPGLPEHFYLA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgcaaaatattcagcctatcctgcccgttcgtatgcaattgggcgaatgtccg
ctgtggcatccggaagaagcagccttgtactggatagatatcgatggtcgcgccgtacat
cgcttcatcccggccaatgacgtgcaccagcaatgggatatgccgtccgaacccggttgt
atcgcgctcaatgccggcagcggcctgctggttgcgctccgttccggcctggccttgctg
gataccaccagcggccagctgacgcagatcgccgatgccccctatgatccggccaccacc
cgcttcaacgatggccgctgcgatgccgccggacgcctgtggaccggttcgatttacgaa
ccgcgtgatcatgcgaatgcggcgctgtactgcgtggaacacggcgagatacgcgatagc
gacaagcgtgccactgtctccaacggcgtcgccttcagccctgacaaccgaaccatgtac
cacgccgataccaccacgcatcgcatcttcgcctatgaattcgatatcggtagcgctacg
ctcggcgaaggtcgcgtattgaaacaattctccaccgacaaacagaataattacggcggt
cgcccggatggtgcggcagttgatagcgaaggcaactactggtgtgcaatgtatgaaggt
ggccgcatcctgcgcctgtccccggccggtgacatcctgtccgagcttgcattgccggta
cgctgtccgaccatgatggcttttggcggcgacgacttgcgcacgctctacatcaccagc
gtcagcaagaatcgcccggcagccgaactggaacaatatccattatccggttgcgtcctc
agcctgcgcgtcgatgtcccgggcttgcccgaacatttttatctcgcataa

DBGET integrated database retrieval system