KEGG   Janthinobacterium sp. Marseille: mma_0390Help
Entry
mma_0390          CDS       T00561                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
mms00020  Citrate cycle (TCA cycle)
mms00640  Propanoate metabolism
mms00660  C5-Branched dibasic acid metabolism
mms01100  Metabolic pathways
mms01110  Biosynthesis of secondary metabolites
mms01120  Microbial metabolism in diverse environments
mms01130  Biosynthesis of antibiotics
mms01200  Carbon metabolism
Module
mms_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mms_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    mma_0390 (sucC)
   00640 Propanoate metabolism
    mma_0390 (sucC)
   00660 C5-Branched dibasic acid metabolism
    mma_0390 (sucC)
Enzymes [BR:mms01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     mma_0390 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: ABR88725
UniProt: A6SUY3
Position
430301..431467
Genome map
AA seq 388 aa AA seqDB search
MNIHEYQGKEILRKYGVTTPKGFPCFSVDEAVQAAEKLGGKVWVVKAQIHAGGRGKGGGV
KVAKSLDEVRKYANDILGMTLVTHQTGPEGRLVKRLLIEEGADIKKELYVGMVVDRGSQR
VALMASSEGGMDIEHVAEHTPEKIHKVFIDPVKGLLDSEADDIARKIGVPEGSIGQARAF
MQGLYKAFDETDASLAEINPLIVTGDDRIVALDAKFNFDSNAMYRHPEIQEMRDLDEEDP
AEIEASKFDLTYISLDGNIGCLVNGAGLAMATMDVIKLYGGSPANFLDVGGGATTEKVTE
AFKIMLKNPDIKAILVNIFGGIMKCDVIAQGVIAAAKQVDLTVPLVVRMAGTNEELGKKI
LAESGLPIITANNMAEAAEKVVNAAQGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccacgagtatcaaggaaaagaaatactgcgtaagtacggtgttacgacacca
aaaggtttcccctgtttttccgtagatgaagctgttcaggctgcagaaaaactcggcggt
aaagtttgggtcgtgaaggcacagattcacgcaggtggccgtggcaaaggcggcggtgtc
aaggttgcaaaatcgctggacgaagtgcgtaaatacgcaaacgacatcctcggcatgacg
ctggtaacacaccaaaccggtcctgaaggccgtctggtaaagcgcttgctgatcgaagaa
ggcgctgacatcaaaaaagaactgtacgtcggcatggtggtcgatcgtggcagccaacgc
gttgccctgatggcatccagcgaaggcggcatggacatcgaacacgtcgctgaacatact
cctgagaaaatccacaaggtattcatcgatccagtcaaaggtttgctcgatagcgaggct
gacgacatcgcccgcaaaatcggcgtaccagaaggttcgattggccaagcacgtgcattc
atgcaaggcctgtacaaagcattcgacgaaaccgatgcatcgttggctgagatcaatcca
ttgatcgttaccggcgacgaccgtatcgttgcactcgacgcgaaattcaacttcgattcg
aacgcaatgtaccgtcatcctgaaatccaggaaatgcgcgatctggacgaagaagatcca
gctgaaatcgaagcatcgaaattcgacctgacctacatctcgctcgacggcaacatcggc
tgcctggttaacggcgctggcctggctatggcaaccatggacgtcatcaagctgtacggc
ggttcgccagccaacttcctcgacgtaggcggcggtgctacgactgagaaagttaccgaa
gcattcaagatcatgctgaaaaacccggacatcaaagcgatcctggttaacatcttcggc
ggcatcatgaagtgcgacgtgattgcgcaaggcgtgatcgctgcagcaaaacaagttgat
ctgacagttccactggtcgttcgtatggctggtaccaatgaagaactgggcaagaagatc
ctggctgaatcgggtcttcctatcatcacggcaaacaacatggctgaagcggctgaaaaa
gtcgtcaacgcagcacaggggaaataa

DBGET integrated database retrieval system