KEGG   Janthinobacterium sp. Marseille: mma_0674Help
Entry
mma_0674          CDS       T00561                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
mms00010  Glycolysis / Gluconeogenesis
mms00020  Citrate cycle (TCA cycle)
mms00620  Pyruvate metabolism
mms01100  Metabolic pathways
mms01110  Biosynthesis of secondary metabolites
mms01120  Microbial metabolism in diverse environments
mms01130  Biosynthesis of antibiotics
mms01200  Carbon metabolism
Module
mms_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mma_0674 (aceF)
   00020 Citrate cycle (TCA cycle)
    mma_0674 (aceF)
   00620 Pyruvate metabolism
    mma_0674 (aceF)
Enzymes [BR:mms01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     mma_0674 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H RnfC_N CAT
Motif
Other DBs
NCBI-ProteinID: ABR88599
UniProt: A6SVR7
Position
769365..770741
Genome map
AA seq 458 aa AA seqDB search
MSMVEVKVPDIGDFKEVEVIELLVKAGDTIKVDQSLITVESDKASMEIPSSHAGVVKEIK
VKLGDKIAEGALVLLLEESAAAPAAAAAPAAEAPKAEAAPAAAPAPAAAAPAPVAAPAPE
PVAAPAAPAPAPVASAPAAAAVPATAANSKAHASPSIRKFARELGVDLGKVAGSGPKGRI
TQEDVQNYVKGIIAAGPVAATAAAPVKSGGGAGLDLLPWPSLDFSKFGTTTLQPLSRIKK
ISGPNLHRNWVMIPHVTQYDEADVTELEELRKSTNTALAKSGVKLTMLAFVIKACVAALK
KYPEFNSSLDANGENLILKQYYNIGFAADTPQGLVVPVVKGVDQKTVTQIAQEMGDLSAQ
AREGKLKPADMQGATFTISSLGGIGGTYFTPLINAPEVAIIGLSKTSMKPVWDGKQFVPR
LIMPLSLSYDHRVIDGAQGARFVTYLSEVLSDLRKSLL
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggtcgaagttaaagtcccggatatcggcgacttcaaagaagtcgaggtgatt
gagctgctggtcaaggcgggcgatacgatcaaggtcgatcaatccctgatcacggttgaa
tccgacaaagccagcatggaaatcccatccagccacgccggtgtagtaaaagaaatcaaa
gtcaaactcggtgacaagattgccgaaggcgcactggttctgttgctggaagaatcagca
gccgctcctgcggccgcggcggcaccagccgctgaagcaccgaaagctgaagctgctcct
gcagcagcgccggccccggcagccgcagctcctgcaccggttgcagcgccggccccagag
ccagtcgcggcacctgctgcgccggcaccagcgcctgtagcatctgcaccggctgccgcc
gcagttccggcaacggctgcaaacagcaaggcacatgcgtcaccgtcgatacgcaagttc
gcacgcgaactcggtgtggatctcggcaaggtcgcgggttcgggtccgaagggacgcatt
acacaggaagatgtacagaattacgtgaagggcatcattgctgcgggtccggttgcggct
actgctgcagcaccggtgaaatccggcggcggtgccggcctcgacctgttgccatggcca
tcgctggacttcagcaagttcggtacgaccaccttgcaaccgctgtcgcgcatcaagaaa
atcagcggtccgaatctgcaccgcaactgggtcatgatcccgcacgtcacgcaatacgac
gaagcggacgtcaccgagctggaagagctgcgtaaatcgaccaacaccgcgttggccaaa
tccggcgtcaaattgacgatgctggcatttgttatcaaggcttgcgttgccgcgttgaaa
aaatacccggagttcaactcttcgctcgatgcaaacggtgaaaacctgatcctcaagcag
tactacaacatcggcttcgccgccgatacgccgcaaggcctggtggttcctgttgttaag
ggcgtggatcaaaaaacggttacgcagattgcacaggaaatgggtgatctgtcggcacag
gcacgcgaaggcaaactgaaacctgctgacatgcagggtgcaaccttcacgatctcatcg
ctgggcggcatcggtggcacttacttcacaccattgatcaatgcgccggaagtggcgatc
atcggcttgtcaaaaacctcgatgaaaccggtatgggacggcaagcaattcgtaccacgc
ctgatcatgcctttgtcgctgtcctacgatcaccgcgtgatcgacggcgcgcaaggcgca
cgcttcgtgacttacctgagcgaagtgttgtccgacctgcgcaagtccctgctgtaa

DBGET integrated database retrieval system