KEGG   Janthinobacterium sp. Marseille: mma_1943Help
Entry
mma_1943          CDS       T00561                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
mms00630  Glyoxylate and dicarboxylate metabolism
mms01100  Metabolic pathways
mms01110  Biosynthesis of secondary metabolites
mms01120  Microbial metabolism in diverse environments
mms01200  Carbon metabolism
Module
mms_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    mma_1943 (aceA)
Enzymes [BR:mms01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     mma_1943 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABR88903
UniProt: A6SZD6
Position
complement(2187771..2189093)
Genome map
AA seq 440 aa AA seqDB search
MANREQQIAALNKDWQENPRWKGVTRNYTAEDVVRLRGSLQVEHTLAQRGADKLWEMCNN
EPFVNSLGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVK
RINNTFQCADQIQWSEGKGDLDFFAPIVADAEAGFGGVLNAYELMKAMIEAGAAGVHFED
QLASVKKCGHMGGKVLVPTREAVEKLNAARLAADVCGTRTLVIARTDAEAADLLTSDVDA
NDKPFLTGERTVEGFYKTRAGFDQAVSRGLAYAPYVDMLWCETGKPDLEFARQFADAIHA
KFPGKMLAYNCSPSFNWRKNLDDATIAKFQKELGAMGYKFQFITLAGFHSLNYSMFNLAH
GYARNQMSAFVELQEAEFAAADKGFTAVKHQREVGTGYFDAITQVIQQGQSSTTALHGST
EDEQFFESKVAKVCIAGRAA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaccgcgagcaacagatagcagcactaaacaaggattggcaggaaaatccgcgc
tggaaaggcgtcacgcgtaactacacggccgaagatgtggttcgcctgcgtggttcgctg
caggtcgagcacacgctggcacagcgcggtgccgacaagctgtgggaaatgtgcaataac
gagcctttcgtcaattcgctcggcgcattgaccggcaaccaggcgatgcaacaggtcaag
gccggtttgaaggccatctatctgtcgggctggcaggtcgccggtgatgccaatgtcgca
ggcgagatgtatccggatcaatcgctgtatccggccaattcggtgccgctggtcgtcaag
cgcatcaataacactttccagtgcgccgatcagatccaatggtcggaaggcaagggtgat
ctggatttcttcgcccccatcgtggcggatgcggaagccggcttcggtggtgtgttgaat
gcctatgaattgatgaaggcaatgatagaagccggcgctgccggcgtgcacttcgaagac
caattggcatcggtcaagaaatgcggacacatgggtggcaaggtgctggtacctacccgt
gaagcggtcgagaaattgaatgccgcacgcctcgcagccgatgtctgcggtacccgcacc
ctggtgattgcgcgtaccgatgcggaggcagccgacttgctgacctctgatgtcgatgcc
aatgacaagcctttcctgaccggtgagcgcacggtcgaaggtttttacaaaacacgtgcc
ggtttcgaccaggccgtttcgcgcggcctcgcgtatgcaccttatgtcgatatgttgtgg
tgcgaaaccggcaagcccgatctcgaattcgcgcgtcaattcgccgatgcaatccacgcc
aaattccccggcaagatgctggcctacaactgttcgccttcgttcaactggaggaagaac
ctggacgacgccaccatcgccaaattccagaaagagctgggcgcgatgggctacaaattc
cagttcatcacgctggccggtttccattcgctgaactactcgatgttcaacctcgcgcat
ggttacgcccgtaatcaaatgtcggccttcgtcgaattgcaggaagccgagtttgcagcc
gcggacaagggcttcactgcggtcaagcaccagcgtgaagtgggcaccggttacttcgat
gccatcacccaggttatccagcaaggccagtcgtccactaccgccttgcatggttctacc
gaggatgagcaatttttcgaaagcaaggtcgcaaaggtttgtattgcagggcgcgccgca
taa

DBGET integrated database retrieval system