KEGG   Janthinobacterium sp. Marseille: mma_2048Help
Entry
mma_2048          CDS       T00561                                 

Gene name
lpxD
Definition
(GenBank) UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
  KO
K02536  UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC:2.3.1.191]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
mms00540  Lipopolysaccharide biosynthesis
mms01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mms00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    mma_2048 (lpxD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:mms01005]
    mma_2048 (lpxD)
Enzymes [BR:mms01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.191  UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase
     mma_2048 (lpxD)
Lipopolysaccharide biosynthesis proteins [BR:mms01005]
 Lipid A
  mma_2048 (lpxD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep LpxD Hexapep_2
Motif
Other DBs
NCBI-ProteinID: ABR88639
UniProt: A6SZP1
Position
complement(2311664..2312716)
Genome map
AA seq 350 aa AA seqDB search
MSTRLGELVERLGGRLIGDADIEVVGIAPLNDADASHITFLSNPKFRGQAAQTHAAALIL
SAADDEVVAADYQGARIVTANPYAYFARAAQFFAALHAHIAPAGIHPSASVDPTAQIAAS
ASIGPFVAVEAGAVIEDGCVIDAGCFIGRDARVGSGTHFYPRVTFLAGCRIGARGIIHSG
AVIGADGFGFANEGGVYIKIPQTGAVRIGDDVEIGANTSIDRGALADTVLEDGVKLDNQI
QIGHNCHIGAHTAMAGCVGVAGSAIIGKYCTFGGAAMVLGHLTIADHVHISSGSMVSRSI
REPGQYTGFYPLAKNAEWEKSAVIVRNLATMREKIRELEKTIKSLGDKPE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagcactcggctgggagaattagtcgaacgcttggggggccggttgataggcgatgcg
gacattgaagttgtcggcatcgcaccgttaaacgatgcagatgcatcgcacatcacgttt
ctttccaatcccaagttcagagggcaggccgcgcaaacacacgcggccgctttaattttg
tctgccgcagacgacgaggtcgtcgcggctgattatcagggtgcgcgcatcgttaccgcc
aatccctatgcctattttgcacgtgcggcacagttctttgccgcgttgcatgcgcatatc
gccccggcgggaatacatccgagtgccagtgtcgatccgaccgcgcagattgctgccagc
gcttcgatcgggccattcgtagcagtcgaggcgggcgcagtgattgaagacggctgcgtg
atcgatgccggctgttttattgggcgcgatgctcgagtcggtagcggtactcatttttat
ccccgcgtgacgtttctggctggctgccggatcggtgcgcgtggcatcatccattccggc
gcagtcataggcgcggatggcttcggttttgcgaatgagggcggggtctatatcaagatt
ccgcagactggcgcggtcaggataggcgacgatgttgagatcggtgccaatacctcgatc
gaccgtggcgcactggcggataccgtgctcgaagacggcgtcaagctggataaccagatc
cagatcggtcacaactgccatatcggtgcgcatacggcaatggccggctgtgtcggcgtg
gcgggtagtgcgatcataggcaaatactgtactttcggcggcgcggcgatggtgctgggg
catttgaccatagctgatcatgtgcacatctcgtccggcagcatggtgtcacgttcgata
cgtgagccgggccaatatacgggcttttatccactggcgaagaatgccgagtgggaaaaa
tcagcggtgattgtgcgcaatttggcgacgatgcgtgagaaaatccgcgaattagaaaaa
actattaaatcgctaggcgataaaccagaatga

DBGET integrated database retrieval system