KEGG   Janthinobacterium sp. Marseille: mma_2052Help
Entry
mma_2052          CDS       T00561                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
mms00900  Terpenoid backbone biosynthesis
mms01100  Metabolic pathways
mms01110  Biosynthesis of secondary metabolites
mms01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    mma_2052 (dxr)
Enzymes [BR:mms01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     mma_2052 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C FAD_binding_2 Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ABR88508
UniProt: A6SZP5
Position
complement(2317126..2318298)
Genome map
AA seq 390 aa AA seqDB search
MQQITILGSTGSVGVSTLDVIARHPDRYSVYALTAQSKVEELAQQCARFKPQVAVVGSAE
AAKKLQVLLDAQGLHTQVGYGEAALCAVASAPECDSVMAAIVGAAGLAPTLAAARSGKRV
LLANKEALVMSGPLLMEAVAASGAILMPIDSEHNAIFQCMPATCQRTPLAHGVEKILLTA
SGGPFLKRDVNTLDQVSWQEAVAHPKWVMGRKISVDSATMMNKGLEVIEAHWLFDLPAER
IEVVIHPQSVVHSMVSYVDGSVLAQLGNPDMRTPIAHALAYPERISSGVPPIDLIQIAQL
SFERPDFLRFPCLKLAYDALQAGGSAPAIMNAANEIAVQAFLDSRIGFRAIDQLIARVMD
VMPSVAITDIESVFAQDRCARELANSFIPS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaatcacgattctgggttcgaccggttcagtcggcgtttcaacccttgatgtt
attgcgcgtcatcctgatcgctattcggtctatgccctgactgcgcaaagcaaggtcgaa
gagctggcgcagcaatgcgcccgtttcaaaccgcaagtcgcggtggtcggctcggctgaa
gcggcaaagaaattgcaggtattactggatgcgcaaggcctgcacacgcaggtcgggtac
ggcgaagcggccttgtgtgcggtggccagcgcgccggaatgcgatagtgtgatggcggcg
attgtcggtgctgccggcctggctcctacgctggcggcggcacgatccggcaaacgggtg
ctgttggcgaacaaggaagcgctggtgatgtcaggccccttgctgatggaagcagtggcc
gccagcggcgcgatcctgatgccgatcgatagcgaacacaatgccattttccagtgcatg
ccagccacttgccagcgtacgccgctggcgcatggcgtggaaaaaatcctgttgaccgca
tccggcggcccattccttaaacgtgacgtcaataccctggaccaggtgagctggcaggaa
gccgttgcccatccgaaatgggtgatgggacgcaagatttcggtcgattccgccaccatg
atgaacaaggggctggaagtcatagaagcgcactggctgttcgatctgccggcggagcgg
atcgaggtcgtgatccacccgcaaagcgtggtgcattcgatggtgtcgtacgtcgatggt
tcggtgctggcgcagcttggcaatccggatatgcgtaccccgattgcccatgcgctggct
tacccggaacgcatcagttccggcgtgccacctatcgatttgattcaaattgcgcaactt
agcttcgaaaggccggatttcttaagatttccctgcctgaaactggcgtatgatgctttg
caggcagggggttccgcacctgcgattatgaacgccgcgaatgaaattgccgtgcaggca
tttctcgacagccgtatcggtttccgtgcaatagaccagttgattgcgcgtgtaatggat
gtgatgccgtcggtggcgattaccgatatcgaatcggtctttgcgcaagatcgttgcgcc
cgtgaattagccaactcgtttataccatcatga

DBGET integrated database retrieval system