KEGG   Janthinobacterium sp. Marseille: mma_2091Help
Entry
mma_2091          CDS       T00561                                 

Gene name
cheB2
Definition
(GenBank) CheB protein-glutamate methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
mms02020  Two-component system
mms02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mms00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    mma_2091 (cheB2)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    mma_2091 (cheB2)
Enzymes [BR:mms01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     mma_2091 (cheB2)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     mma_2091 (cheB2)
Two-component system [BR:mms02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   mma_2091 (cheB2)
Bacterial motility proteins [BR:mms02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    mma_2091 (cheB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: ABR89008
UniProt: A6SZT4
Position
complement(2360381..2361460)
Genome map
AA seq 359 aa AA seqDB search
MKIKVLIVDDSALIRSVMKEIINSQPDMEVVGVAPDPIVARDLIKQTNPDVLTLDVEMPR
MDGLDFLEKLMRLRPMPVVMVSSLTERGSDITLRALELGAVDFVTKPKMSIQSGMLEYTE
LIADKIRTASKARIKSRQITPHDPNKVAGDGVLPLIRNPLTSSEKLIIIGASTGGTEAIK
DFLMQMPSDCPGILITQHMPPGFTKSFAQRLDSLCKISVKESEGGERVLPGHAYLAPGHS
HLQLVRSGANYMTQLDQGPPVNRHRPSVDVLFHSAAVHAGKNAVGVILTGMGKDGALGML
EMKNVGAYNFAQDEASCVVFGMPREAIAVGATHEVGPLNALPGMVLGYLAAHSSRALRV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaagtattgatcgtcgatgattcagcgctgatacgcagcgtgatgaaagag
atcatcaacagccagccggatatggaagtcgtcggcgtcgccccggacccgatcgtcgca
cgcgatctgatcaagcagaccaatcctgatgtgttgacgctggacgtcgagatgccgcgc
atggatggcctcgacttcctcgaaaagctgatgcgcttgcgtccaatgccggttgtgatg
gtgtcatcgctgaccgagcgcggttcggacatcactttgcgtgcattggaactgggcgcg
gtcgattttgtgaccaaaccgaagatgtctatccagagcggcatgctggaatacaccgaa
ttgatagcagacaaaatccgtactgcttccaaggcgcgcattaagtcccgccagatcaca
ccgcacgatccgaacaaggtcgccggtgatggcgtgttgccgctgatacgtaacccgctc
accagtagtgagaagctgatcatcatcggtgcgtcgaccgggggtaccgaggcgatcaag
gatttcctgatgcaaatgccatccgattgccccggcattttgatcacgcaacacatgcca
ccaggcttcaccaaatcgttcgcgcagcggctcgacagcctgtgcaagattagtgtgaag
gaatccgaaggtggtgaacgcgtactgccgggtcatgcttacctggcacccggccattca
catttgcaactggtgcgtagtggtgccaactacatgacgcaactggaccaggggccgccg
gtgaatcgtcatcgtccatccgtcgatgtgctcttccattcagccgcagtgcatgcgggc
aagaatgctgtcggtgtaattcttacaggcatgggtaaggatggagcactcggtatgctg
gagatgaaaaacgttggtgcatataactttgcgcaagacgaggcttcttgcgtagtattc
ggtatgccgcgcgaagcaattgccgttggtgcaacacatgaggtcggaccgttgaatgcc
ttgccgggcatggttctcggttatctcgctgcacacagcagcagggcactgcgcgtctaa

DBGET integrated database retrieval system