KEGG   Janthinobacterium sp. Marseille: mma_2570Help
Entry
mma_2570          CDS       T00561                                 

Gene name
purN
Definition
(GenBank) phosphoribosylglycinamide formyltransferase
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
mms00230  Purine metabolism
mms00670  One carbon pool by folate
mms01100  Metabolic pathways
mms01110  Biosynthesis of secondary metabolites
mms01130  Biosynthesis of antibiotics
Module
mms_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    mma_2570 (purN)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    mma_2570 (purN)
Enzymes [BR:mms01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     mma_2570 (purN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N Longin
Motif
Other DBs
NCBI-ProteinID: ABR88979
UniProt: A6T163
Position
complement(2898901..2899530)
Genome map
AA seq 209 aa AA seqDB search
MRRIVILISGRGSNMRAIIRAAQNEEWPARIAAVISNKADASGLAYAAEHGISTLVVANK
DYPSREAFDAALQSKIDSFMPDLVVLAGFMRVLTTPFVAHYADRMLNIHPSLLPSFVGLA
THRQALAAGVKLHGATVHFVTAELDHGPIVAQAAVPVLADDTEESLAARVLEQEHIIYPR
AIRCFLDGRLSVHDGVVRIRPDASEAQAG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaatcgtcattttgatttcggggcgcggcagtaatatgcgggccatcatccgc
gctgcgcaaaatgaggaatggccggcacggattgcggccgtcatcagcaataaggcggat
gcatcgggtttggcttatgccgccgaacacgggatttctaccctggtggtcgccaataaa
gactatccgagcagggaagcctttgatgcagccttgcaaagcaagatcgactcttttatg
ccggatttggtggttttggctggttttatgcgggtgttgacgacaccttttgtcgcgcat
tatgccgatcgcatgctgaatatccacccgtcgctgttgccaagttttgttggtttggca
acgcacagacaggcgctggcggccggggtcaaattgcatggtgcgaccgtgcactttgtg
actgccgagctggaccatggtcctatcgtggcgcaggcggcggtgccggtgctggccgac
gataccgaagaaagcctggccgcacgtgtgctggaacaggaacacattatttatccccgc
gcgatacgctgcttcctggatggacgtttgtccgtgcatgacggtgtagtgcgtattcgt
ccggacgcaagcgaagcgcaagccggctaa

DBGET integrated database retrieval system