KEGG   Janthinobacterium sp. Marseille: mma_3050
Entry
mma_3050          CDS       T00561                                 

Definition
(GenBank) outer membrane cation efflux system protein
  KO
K15725  outer membrane protein, heavy metal efflux system
Organism
mms  Janthinobacterium sp. Marseille
Brite
KEGG Orthology (KO) [BR:mms00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mms02000]
    mma_3050
Transporters [BR:mms02000]
 Other transporters
  Pores ion channels [TC:1]
   mma_3050
SSDB
Motif
Pfam: OEP
Other DBs
NCBI-ProteinID: ABR91610
UniProt: A6T2J3
Position
3416655..3417869
AA seq 404 aa
MFASSIFCRLCLLAALVLTAPIALSESNTPLSIAVDAAWQRSPLARTLEARRGESVAGQE
SAQSWIAGSPSVGLSQRNDRGSNQTGYRETEVSVSAPIWLPGQRSARESLATVNAEELEA
QIAQTRLAIAGEVREQLWAVAAAREELAEVQDHQRHLDALSGDVMRRVKAGDLARTDGLL
AQQEVLAAKSAITVAQTRLQVATARYVTLTGQQSIPSPVPEPIAVSMQEPHPRMLFARKS
IQRSQASLHAVNSTRSDPPTVGLLMRREQDGLVSGSTQSVGIAVQIPFGTNARNLPLESA
ALTKIETARAEAAQTESILQSDIELARQQLTAAEQGLQAASERAALTREHTELIAKSFRM
GERGLNDLLRSHALSHEADVSERQQKVAVGLAHARLNQALGILP
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgtttgccagttctatattttgtcgtttatgtcttttagccgcattggtgcttacagca
cctatagccctatctgaatccaatacgccgctctcgattgcagtggatgccgcctggcaa
agatcgcctttggctcgtacgcttgaagcccgccgaggcgagtctgttgcaggccaggaa
tcagcgcaatcttggattgccggctccccttcagttggcttatcccaacgcaatgaccgc
ggaagcaatcaaaccggttatcgcgaaacagaggtttctgtttccgcaccgatttggttg
ccaggccagagatcagcacgagagtccttggccactgtcaacgctgaagagttagaagcg
caaatagcgcaaacgcgcctagctatcgccggcgaggtacgcgaacagctatgggcagtt
gctgccgctcgcgaagagctggcggaggtgcaggatcatcagcgtcaccttgacgcactc
tctggtgatgtcatgcgtcgtgtaaaagcgggagaccttgctcgcactgatggtttgctc
gcacagcaagaagtcctcgctgcaaaaagtgcaatcaccgtcgcacagactcggctacaa
gttgcaacggcccgctacgttacgctaaccggccagcaaagcatcccgtcccctgtacct
gaacctattgcagtatcaatgcaagagccgcatccccgaatgctgtttgcgcgtaaatca
atacagcgttcgcaagcgtctcttcatgcagtgaactcgacgcgtagcgacccacctact
gttggcttattaatgcgacgtgaacaagatgggttggtgagcgggtccacccagagtgtc
ggaattgctgtccagattccattcggaacaaatgcgcgcaaccttccattagagtcggca
gcactcaccaaaatcgaaaccgctagagcagaagcagcgcaaaccgagagcatccttcaa
agcgatatagaactggcacgccaacaactaacagccgccgagcaagggctgcaagctgct
tcggagcgtgccgcgcttacacgagaacataccgagctgattgccaagtcatttcgtatg
ggcgaacgtggattgaacgatctattacggtctcatgcactcagccatgaagctgatgta
agtgaaagacagcagaaagtcgcagtgggactagcccatgcgcgtttaaatcaagcctta
ggaatactcccgtga

DBGET integrated database retrieval system