KEGG   Janthinobacterium sp. Marseille: mma_3288Help
Entry
mma_3288          CDS       T00561                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mms  Janthinobacterium sp. Marseille
Pathway
mms00340  Histidine metabolism
mms01100  Metabolic pathways
mms01110  Biosynthesis of secondary metabolites
mms01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mms00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    mma_3288 (hisD)
Enzymes [BR:mms01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     mma_3288 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABR89046
UniProt: A6T381
Position
complement(3657482..3658795)
Genome map
AA seq 437 aa AA seqDB search
MSIQIRKFDSTHPDFRQQLADVLAFEASEDEAIDRAVLRILEDVKKRGDVAVLEYTKQFD
HVEADSLQALEIKSADLQAALAQLSPVRRAALQTAADRVRAYHERQKNEIGSDGFSYTEA
DGTILGQKVTPLDRVGIYVPGGKAAYPSSVLMNAIPAKVAGVQEVIMVVPTPNGVQNELV
LAAAAMSGVDRVFTIGGAQAVAALAYGTATIPQVDKIVGPGNAYVAAAKRRVFGTVGIDM
IAGPSEILVVCDGTTNPDWIAMDLFSQAEHDELAQSILICPDAAYLDAVADSINRQLADM
PRKDVITTSLTNRGAMIKVRDMDEACEIANLIAAEHLEISTENPQQWADKIRHAGAMFLG
RFSSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSMLQVSEGGAQTLGKVAAELA
YGEGLQAHARSAEYRLK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtccatacagatacgcaaatttgattccacccatcccgacttccgccagcaactggct
gacgtgctggctttcgaagccagcgaagacgaggcgattgatcgtgcggtgctgcgcatc
ctcgaagatgtgaaaaaacgcggcgatgtcgcagtgctggaatacacgaagcagttcgac
catgtcgaggcggatagccttcaagccctggaaatcaagagcgccgacctgcaagccgct
ttggcgcaattgtcaccggtgcgtcgtgccgccttgcagactgcagcggatcgcgtgcgt
gcgtatcacgaacggcaaaaaaacgagatcggttctgacggctttagctacaccgaagcg
gacggcactatcctcggccagaaagtgacaccgctggatcgcgtcggcatttatgtgccg
ggcggtaaggcagcttatccgtcatcggtattgatgaacgcgatcccggccaaagtcgcc
ggtgtgcaggaagtcatcatggtggtaccgacaccgaatggtgtgcagaatgaactggtg
ctggccgcggctgcgatgtccggtgtagatcgcgtatttacaatcggtggtgcgcaggcg
gttgccgcgctggcctacggtacggcgactattccgcaagtcgacaagatcgtcggcccg
ggcaatgcctatgttgcggcagccaagcgccgtgttttcggtaccgttggtatcgacatg
attgccggcccatcggaaatcctggtggtatgtgacggcaccaccaatcccgactggatt
gcgatggacttgttttcgcaagccgagcatgatgaactggcgcaatccatcctgatttgc
ccggatgcggcttacctcgatgcggtcgcagacagtatcaatcggcaactggccgatatg
ccgcgcaaggatgtaatcaccacatcgctgacgaatcgcggtgcgatgatcaaggtgcgc
gacatggatgaagcgtgcgagatcgccaacctgatcgctgccgaacatctggaaatttcg
accgaaaatccgcagcagtgggcggacaagatccgccatgccggcgcgatgttcctcggc
cgcttttcttccgagtcgcttggtgattactgcgccggtccgaaccatgtgttgccgact
tcgcgtactgcgcgtttctcttcacctttgggcgtctacgatttccagaagcgttccagc
atgctgcaagtcagcgaaggtggtgcgcagacgctgggcaaggttgcggctgaactggct
tacggcgagggcttgcaggcgcacgcccgttctgcggaatatcggctgaaatga

DBGET integrated database retrieval system