KEGG   Janthinobacterium sp. Marseille: mma_3406Help
Entry
mma_3406          CDS       T00561                                 

Gene name
rplV
Definition
(GenBank) large subunit ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mms  Janthinobacterium sp. Marseille
Pathway
mms03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mms00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    mma_3406 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mms03011]
    mma_3406 (rplV)
Ribosome [BR:mms03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    mma_3406 (rplV)
  Bacteria
    mma_3406 (rplV)
  Archaea
    mma_3406 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ABR88994
UniProt: A6T3J9
Position
complement(3777310..3777642)
Genome map
AA seq 110 aa AA seqDB search
MMETKATLRGVRLSAQKGRLVADQIRGKKVDQALNILQFSPKKGAAIIKRVLESAIANAE
HNDGADIDELKVTTIYVEKGSVLKRFTARAKGRGDRISKQSCHIYVTVGN
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaactaaagctaccctccgtggtgtgcgcctgtcggctcagaagggccgcctt
gtggcagaccagatccgcggcaaaaaagtggatcaagcgctcaatatcctgcaattcagc
cctaaaaaaggtgctgcgattatcaaacgtgtgttggagtccgcaattgcgaacgccgag
cacaatgatggtgcggatatcgacgaattgaaagttacaacgatttacgttgaaaaaggt
tcggtcttgaagcgcttcacagcgcgtgcaaaaggccgtggtgatcgtatctctaaacaa
tcctgtcacatttacgtgactgtcggtaattaa

DBGET integrated database retrieval system