KEGG   Janthinobacterium sp. Marseille: mma_3423Help
Entry
mma_3423          CDS       T00561                                 

Gene name
rplA
Definition
(GenBank) large subunit ribosomal protein L1
  KO
K02863  large subunit ribosomal protein L1
Organism
mms  Janthinobacterium sp. Marseille
Pathway
mms03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mms00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    mma_3423 (rplA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mms03011]
    mma_3423 (rplA)
Ribosome [BR:mms03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    mma_3423 (rplA)
  Bacteria
    mma_3423 (rplA)
  Archaea
    mma_3423 (rplA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L1
Motif
Other DBs
NCBI-ProteinID: ABR88721
UniProt: A6T3L6
Position
complement(3799885..3800580)
Genome map
AA seq 231 aa AA seqDB search
MAKLSKRVKAFKAKVDRTKAYPFDNAVALIKECASAKFDESIDISVQLGVDAKKSDQVVR
GSVVLPAGTGKSVRVAVFATGEKAGQAKAAGADIVGMDDLAEQIKAGNMPFDIVIASPDT
MRIVGTLGQILGPRGMMPNPKVGTVTPDVATAVKNAKAGQVQYRTDKAGIIHATIGRKSF
SDEALKSNLLALIDALNKAKPATSKGVYLRKVSLSSTMGAGVRVDQSTLAA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggctaagttatcgaaacgcgtaaaagcatttaaagcaaaagttgaccgtaccaaagcg
tacccgttcgacaatgcagttgctttgatcaaagaatgcgcatcggcaaaattcgatgaa
tcgatcgatatttcggttcaattgggtgttgatgccaagaaatccgaccaagttgttcgt
ggttccgttgttttgccagcaggtaccggtaaatcggtccgcgttgcggtttttgcaact
ggcgaaaaagcagggcaagcgaaagcagctggtgcagatatcgttggtatggacgacctg
gctgagcaaatcaaagctggcaacatgcctttcgacatcgttatcgcatcgccagatacc
atgcgtatcgttggtaccctgggtcaaatcctgggcccacgcggcatgatgcctaacccg
aaagtcggtactgttactcctgacgtcgctactgcagttaaaaatgcaaaagctggtcaa
gttcaataccgtactgacaaggctggcattatccacgccaccatcggtcgtaaatcgttc
tccgacgaagcgctcaaatccaacttgttggctttgatcgatgcgttgaataaagctaag
ccagcaaccagcaaaggtgtttacctgcgcaaggtttcgctgtcgtcgacgatgggcgct
ggtgtacgcgtcgatcaatcgaccctggctgcttaa

DBGET integrated database retrieval system