KEGG   Methylomonas methanica: Metme_0261Help
Entry
Metme_0261        CDS       T01511                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
mmt  Methylomonas methanica
Pathway
mmt00471  D-Glutamine and D-glutamate metabolism
mmt00550  Peptidoglycan biosynthesis
mmt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Metme_0261
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Metme_0261
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mmt01011]
    Metme_0261
Enzymes [BR:mmt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Metme_0261
Peptidoglycan biosynthesis and degradation proteins [BR:mmt01011]
 Precursor biosynthesis
  Amino acid ligase
   Metme_0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C TrkA_N XdhC_C NAD_binding_8 FAD_binding_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AEF98710
UniProt: F9ZZQ1
Position
complement(285466..286830)
Genome map
AA seq 454 aa AA seqDB search
MNSDTFLNAVNTHFKLDPADARLLIVGLGATGYSAAQFLQQTPIKFAVIDSRSNPPQIDS
LREQMPDVPVFSGGFDQSAFEVATHLLISPGVSLNEKAISKAVRAGVTIISDIDLFACAT
DKPIIAITGSNGKSTVTTMLGDMGNAAGYKTAIGGNLGTPALDLLQQDADLYVLELSSFQ
LERTSALNAKAATVLNLSADHLDRHVGMSGYAQEKQRIFRGDGAMILNADDPMVMAMLDR
SRTHFGFSVREPADFYLKRGDVDQLMFKDEVLMNADDLNLEGSHNIANALASLALGHAVG
MDMNAMCRALRKFKGLPHRMQKVAEIRGVRWVNDSKATNIGACIAALQGYDRKVILIAGG
DGKGADMAELKPIVQEKTKAVVLMGKDAQLIDTALQNCVPTRLAANMREAVSIAAGLAEA
GDSVLLSPACASLDQYKSYVDRGNQFAQAVLELP
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtgacacctttctcaacgcggtgaacacccatttcaagctggacccggccgat
gcccggctgttaatcgtcggtctgggcgctaccggctattcggccgcgcaatttttacag
caaacgccgataaaattcgccgtgatcgacagtcgcagcaatccgccgcaaatcgacagt
ttgcgcgaacaaatgccggatgtacccgtgttttccggcggcttcgatcagtcggccttt
gaagtggcgacccatctgctgatcagtcccggtgtctcgttgaatgaaaaagccatatcc
aaagcggtaagggcgggcgtcacgataatcagcgacatcgatttgtttgcttgcgccacc
gacaagcccatcatcgccatcaccggctccaacggcaaaagcaccgtcacgaccatgttg
ggcgatatgggcaatgccgccggctataaaacggctatcggcggcaatttaggtacgccg
gccctggacttattgcaacaggatgccgacctgtacgttttggaactgtccagctttcaa
ttggaacgcacctcggcgctgaatgccaaggcggcgaccgtgttaaatctcagtgccgac
catctggaccggcacgtcggcatgtccggctatgcgcaagaaaaacagcgcatttttcgc
ggcgatggcgccatgatcctgaatgccgacgatcccatggtgatggccatgctggaccgc
agccgaacgcactttggtttttccgtgcgggaacctgcggacttttatctgaaacgcggc
gatgtcgaccagttaatgttcaaagatgaagtgttgatgaacgccgacgatttgaatctg
gaaggcagtcataatattgctaacgcactggcctcgttggccctgggtcatgcggtcggc
atggacatgaacgccatgtgccgggcactgcgaaaattcaaaggtttaccgcaccgcatg
cagaaagtcgccgaaatacgcggcgtacgctgggtcaacgactccaaagccaccaatatc
ggcgcctgtatcgcggcgctgcaaggctatgaccgcaaagtcattctgattgccggcggc
gatgggaaaggcgccgacatggccgagcttaaaccgattgtgcaggaaaaaaccaaagcc
gtggtgttgatgggtaaggacgcacagctaatcgacaccgcgttgcaaaactgcgtgccc
acccgccttgccgccaatatgcgcgaagcggtcagtatcgccgcaggtctggcggaagcc
ggcgacagcgttttgctatcgccggcctgtgccagcctggatcaatataaaagctacgtc
gatcgtggcaaccaattcgctcaagccgtgctggagttgccgtaa

DBGET integrated database retrieval system