KEGG   Methylomonas methanica: Metme_0853Help
Entry
Metme_0853        CDS       T01511                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
mmt  Methylomonas methanica
Pathway
mmt03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mmt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Metme_0853
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmt02044]
    Metme_0853
Secretion system [BR:mmt02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Metme_0853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: AEF99291
UniProt: G0A6J0
Position
918983..919465
Genome map
AA seq 160 aa AA seqDB search
MAVDMFLKIKDVKGEAQDDKHKDTIDVLAWSWGMSNSGSTHMGGGSGAGKVNVQDISVTK
YIDKSSPDLMKACCNGKHFETADLIVRKAGEKPVEYLTITMTDLIVTSVSTGGSGGEDRL
TENVTLNFGAVKVKYIEQTAKGGEGAKPDMGWDIAANKAL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggcagttgatatgtttttgaaaatcaaagatgtaaaaggtgaagcacaggacgacaag
cacaaagataccatcgacgtgctggcctggagttgggggatgtccaatagtggctcaact
catatgggtggtggttccggcgctggaaaagtcaatgtgcaggatatcagtgtaactaaa
tacattgacaaaagtagtcctgatctgatgaaggcatgctgcaacggtaaacactttgag
acagcggatttaatcgtccgtaaagcgggtgagaaaccggttgagtatttaaccattacg
atgacggatttgatcgtgacttctgtttccactggcggctcgggcggtgaagatcgtttg
accgaaaatgtcacgcttaacttcggtgcagtcaaagttaaatacatcgaacaaaccgcg
aaaggcggtgaaggcgcgaaacccgacatgggttgggatattgcggcaaacaaagcgctt
taa

DBGET integrated database retrieval system