KEGG   Methylomonas methanica: Metme_2000
Entry
Metme_2000        CDS       T01511                                 

Definition
(GenBank) integrating conjugative element protein, PFL_4693 family
Organism
mmt  Methylomonas methanica
SSDB
Other DBs
NCBI-ProteinID: AEG00411
UniProt: G0A581
Position
2197607..2198383
AA seq 258 aa
MLGKMSPKRQRHVLISLLLLIGLQLPAQAKESQAQPLTYTESKAQSVEEETRLRQHWSLS
IDEWRRYKSLMKGIRGSISPPNISPIEVLGTHARNDQERRRYAEIWARMRHEDAERILAF
QQAYAEAFQRLYPNELLVDLSRLKSSSQPVSASGSRLLVFLKIKQCQACESLVQRLLQQP
VFNTQPIDLYFVDTQPQRDDALIQQWAKQQHLDSARIKQGLLTLNHDQGNYFKVSQQLVG
TMPQVFKLTGQTLEALRL
NT seq 777 nt   +upstreamnt  +downstreamnt
atgctcggcaagatgagccctaagcgtcaacgtcacgttttgatttctctattgctacta
atcgggctgcaactgccggcgcaggcaaaggagtcccaggctcagccattgacttacacc
gaatcgaaagcccagtctgttgaagaggaaacacgcctccgccaacactggtcattatcg
atcgacgaatggcgccgctataaaagcctgatgaaaggcattcgcggcagcatcagtccg
ccgaatatttccccgatcgaagtgttgggcacccatgcccgcaacgatcaggaacgccgg
cgctatgccgaaatctgggccagaatgcgccatgaagatgccgaacgtattctggctttt
caacaggcttatgccgaagcctttcaaagattgtatcccaacgaattgctcgttgatttg
agccgattaaaatcatcttcccaaccggtctccgcctcgggtagccgcttattagtgttc
ttaaaaatcaaacagtgccaagcgtgtgaaagcctggtgcagcgtctattacagcagccg
gtgttcaacacccagccaatcgatttgtactttgtcgatacccaaccgcaacgcgacgat
gccttgattcagcagtgggctaaacaacagcatctcgacagcgcccgtataaaacagggc
ttgttgacattgaatcatgatcagggcaattattttaaagtcagccagcaactggtaggc
acgatgccacaggtcttcaaactgaccggccaaacgttggaagctctgcgattataa

DBGET integrated database retrieval system