KEGG   Methylomonas methanica: Metme_2013Help
Entry
Metme_2013        CDS       T01511                                 

Definition
(GenBank) integrating conjugative element protein, PFL_4695 family
Organism
mmt  Methylomonas methanica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2859 Tom6
Motif
Other DBs
NCBI-ProteinID: AEG00423
UniProt: G0A593
Position
2208606..2209097
Genome map
AA seq 163 aa AA seqDB search
MRYQLTVCGVLLISSPLLSMAEPVVLYDSGRTTRLPIQPQTLHLQTPVTANFDVQIDTLP
IKTPSLSPGNVVSRRIDRLYLDRPVFLVGADPLSMHWLVLHQAQLKQLHAIGLAVNVETQ
AQLQQLRKTAGGLEIHPLAGDAMAAQLALQHYPVLITASRIEQ
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcggtatcagctgaccgtctgtggtgttctattaatcagttcgcctttgctgagtatg
gcagaaccggtggtgctttatgacagcggccgcaccacgcggttgccgattcagccgcag
acactgcatctgcaaacacccgtcaccgctaactttgatgtacaaatcgatactttgccg
atcaaaaccccgtcgttgtcgccgggtaatgtggtttcccgccgtattgatcggctgtat
ctggatcgaccggtgtttttggtcggtgctgatcccttgtccatgcactggttagtgttg
catcaagctcaactcaagcagcttcacgccatcggtctggcggtcaatgtcgaaacccag
gcgcaattacaacaattgcgaaaaaccgcaggtggcttggagatccatccgctggccggc
gatgccatggccgcgcaattggccctgcaacattacccggtgttgatcacggcgtcgcgg
atcgaacaatga

DBGET integrated database retrieval system