KEGG   Methylomonas methanica: Metme_2034
Entry
Metme_2034        CDS       T01511                                 

Definition
(GenBank) integrating conjugative element protein, PFL_4711 family
Organism
mmt  Methylomonas methanica
SSDB
Motif
Pfam: Parvo_coat_N LemA
Other DBs
NCBI-ProteinID: AEG00442
UniProt: G0A5Z2
Position
2228352..2229713
AA seq 453 aa
MQTPIVCLVMLGCLANFNAPLCAAPFANSDNSDFYYEIGGARSISVPANTQVNTYAINGA
FELGLGYSCGNFDPTLGVANLLNGLQQTGNNLVNGAVGAVQAAIGGLPALVLQRIDPGLY
DLFQNAVIRAEAVIALANKTCEDYEQAIRQGQNPYADWSDLSKIIDWKVQMGKNGYGSAK
NDVVQAKQNVQKANGQNGIPWIGGKKAGGVKQAAIQVTHDSVTAGYNLTLNRQANDSSAP
KKSKSTPRLAEVFADPGKASQWAVDVLGDVHIRTHDNHPVETIPGYGLLPKVEKDMQTIQ
KDLTDLVSGKTRTTLANLENVSSDAVLINGDVIAAIKTLKPSERAVAISKLASEAAMTRT
VEKAMLIRRLLLTATREPNLSATEATTAIQASIDQLDRDIADVLFERKIHNELASKTSAL
LLALQRQQTERGRAYQRPAGSDEAILQEEAIKP
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgcaaacacctatagtctgtttagtcatgctaggctgcttggcgaacttcaatgcgccg
ctttgtgcggccccgtttgccaatagcgacaacagcgatttttactatgaaatcggcggc
gcccgttcgatctcggtgccggccaatacgcaagtcaatacctacgccatcaacggagcg
tttgaactcggtttgggttacagctgcggaaatttcgatcccaccctgggggtggcgaat
ctactgaatggcttgcagcaaaccggcaacaacttagttaatggtgccgtcggtgcagtg
caggcggctatcggtggtttaccggctttagtattgcagcgcatcgatccgggattatat
gacctgtttcaaaatgcggtgatcagggctgaggccgttatcgcattggccaataagacc
tgtgaagactatgagcaggcaatccgtcaaggtcaaaacccgtatgctgattggagtgat
ctttccaagattatcgactggaaagtgcagatgggtaaaaacggttacggcagtgccaaa
aatgatgtcgtgcaagccaagcaaaacgtgcaaaaagccaacggccagaacggtattccg
tggataggcggcaaaaaagccggtggagtaaaacaagcggctatccaggtgacccatgat
agcgtaacggccggctataacctgactttaaatcgtcaggccaatgacagctcggcacct
aaaaagtcaaaaagtacgccgcggctggcggaagtgttcgccgatccgggcaaggcttcg
caatgggcggttgatgtgctaggcgatgtgcatatccgtacccatgacaatcatccggtt
gaaaccattcctggatacggtcttttgcccaaagtcgaaaaagacatgcagaccattcaa
aaggatttaaccgatttggtgtccggcaaaacccgaacgacgctggctaatctggaaaac
gtttccagcgatgccgtgttgattaacggcgatgtcattgccgcgatcaaaaccctgaaa
ccttccgaacgagcggtagccatcagcaagctggcttcggaggctgcaatgacccgcaca
gtggaaaaagccatgttgattcggcgcctgttgctaaccgccactcgcgaacccaatctc
agtgccaccgaggcgacgacggccattcaagcgtccattgaccagctagatcgtgatatc
gctgatgtgttgttcgaacggaaaattcataacgaattggcctcgaaaacctctgctttg
ttattggctttacaacggcaacagaccgaacgcggccgggcctatcagcgcccagcgggt
tccgatgaagcgattttgcaagaagaggccatcaagccatga

DBGET integrated database retrieval system