KEGG   Methylomonas methanica: Metme_3114Help
Entry
Metme_3114        CDS       T01511                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase-like protein
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
mmt  Methylomonas methanica
Pathway
mmt00670  One carbon pool by folate
mmt01100  Metabolic pathways
mmt01120  Microbial metabolism in diverse environments
mmt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Metme_3114
Enzymes [BR:mmt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     Metme_3114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AEG01490
UniProt: G0A3L8
Position
complement(3445554..3446327)
Genome map
AA seq 257 aa AA seqDB search
MNISFEIVPRTLDAFEKQYAFVQSLNDCINIINVPDIQRFAMRSWQLARHVDRNQYRFIP
HFRAIDFKIESGELYRIIEGYQLDNVLLVTGDPPEGLKRSYCNTDVVDLIRAVRRRFPKL
NIYAGFDPHRQGLQHECHYIQRKADAGANGFFSQPFYDHRLVELFAEHMDGLETYIGISP
VVTSASQNYWEVKNHVKFPKHFRPDYDWNVEFANRLIGSAAENGWHVYFMPIKVELKKYF
ERIKLASPSPTTLSVTG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaacatttcgtttgaaatcgtccccagaaccttggacgcctttgaaaaacaatatgcg
tttgtgcagagtctgaatgactgcattaatatcatcaacgtaccggatatccagcgcttc
gctatgcgcagctggcaactggcgaggcatgtcgatcggaaccaataccggtttattccg
catttccgggccatcgatttcaaaatcgaaagcggcgagctgtatcgcattattgaaggt
tatcagctcgacaacgtgttgctggtcaccggcgacccgccggaaggcctgaaacgcagc
tattgtaataccgacgtggtagacctgatccgggcggtacgcaggcgctttccgaaactg
aacatctatgccgggtttgatccgcatcgacaaggcttgcaacacgaatgccattatatc
cagcgcaaggccgatgccggcgccaacggttttttttcgcaaccgttctacgatcatcgg
ctggtggaactgtttgccgaacacatggacggcctggaaacctatatcggtatcagccct
gtggtgacgtcggcctcgcagaattattgggaagtgaagaatcatgtcaaatttcccaag
catttccggccagattacgattggaatgtcgagttcgccaaccggctgatcggctcggcg
gcagagaacggttggcatgtgtatttcatgccgatcaaggtagagttaaaaaaatacttc
gaacgcatcaaattggccagtccaagtcctaccaccctatctgtaacaggttga

DBGET integrated database retrieval system