KEGG   Methylomonas methanica: Metme_3290Help
Entry
Metme_3290        CDS       T01511                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmt  Methylomonas methanica
Pathway
mmt00010  Glycolysis / Gluconeogenesis
mmt00051  Fructose and mannose metabolism
mmt00562  Inositol phosphate metabolism
mmt01100  Metabolic pathways
mmt01110  Biosynthesis of secondary metabolites
mmt01120  Microbial metabolism in diverse environments
mmt01130  Biosynthesis of antibiotics
mmt01200  Carbon metabolism
mmt01230  Biosynthesis of amino acids
Module
mmt_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metme_3290
   00051 Fructose and mannose metabolism
    Metme_3290
   00562 Inositol phosphate metabolism
    Metme_3290
Enzymes [BR:mmt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Metme_3290
Exosome [BR:mmt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Metme_3290
  Exosomal proteins of bladder cancer cells
   Metme_3290
  Exosomal proteins of melanoma cells
   Metme_3290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEG01661
UniProt: G0A5F5
Position
complement(3625004..3625750)
Genome map
AA seq 248 aa AA seqDB search
MRQPLIMGNWKMNGSREEGVQLAKALADGLNAGSQEVAVCVPFVYVSDIRGALASSPIAL
GAQNVADQASGAYTGEISAAMLADCGVKYALVGHSERRSYYGDTSQSVANRFCQAQKQNV
IPVLCVGETLEEREQDRTFQVVDEQLDAVIDAAGIEAFANAVIAYEPVWAIGTGKTASDE
QAQEVHQYIRKRIADRNPAIAEKVQILYGGSVKPDNAKGLFAMPDIDGGLVGGASLDAKG
FLQICHSV
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaacctttgatcatgggaaactggaaaatgaatggctctcgggaagagggcgtg
caactggcgaaagccttggcggacggcttaaacgcaggcagccaggaagttgcggtttgt
gttccttttgtctacgtgtcagatattcgcggcgcattggcttcatctcctatcgctctg
ggcgcgcaaaacgtggccgaccaagcctccggcgcatacaccggcgaaatttcagccgcc
atgctggccgattgcggcgttaaatatgcgttagtgggccactcggaaagacgctcttac
tacggcgataccagccaaagcgtagccaatcggttctgccaagcgcaaaaacaaaatgtg
attccagtgctgtgtgtcggtgaaaccctggaagagcgcgaacaagacagaactttccaa
gttgttgacgagcaattggatgcggttattgatgctgccggcatcgaagcatttgcaaat
gcggttatcgcttacgaacctgtttgggcaatcggcaccggcaaaaccgccagtgacgaa
caagcgcaagaagttcaccaatacatccgtaagcgcattgcggatagaaaccctgctatt
gccgaaaaagtacaaattttgtacggcggtagcgttaaaccagacaacgctaaaggcttg
tttgccatgccggatatcgatggcggcctagtaggcggcgcttcgctggatgcaaaaggt
ttcttgcagatttgtcattcagtttag

DBGET integrated database retrieval system