KEGG   Methylomonas methanica: Metme_3389Help
Entry
Metme_3389        CDS       T01511                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  diguanylate cyclase [EC:2.7.7.65]
Organism
mmt  Methylomonas methanica
Brite
Enzymes [BR:mmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Metme_3389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF EzrA Reo_sigmaC Leu_zip IpaC_SipC DNA_pol3_tau_5 COG5 Baculo_PEP_C Tropomyosin_1 KxDL TMF_DNA_bd
Motif
Other DBs
NCBI-ProteinID: AEG01760
UniProt: G0A6D2
Position
3735252..3736286
Genome map
AA seq 344 aa AA seqDB search
MQKNSSSIKSSTDILKQAIQFIGQHNITAIPINYTVSYEYCRGHHVLLRQAIDQAIVNKQ
PITNEAIQGWFDAFLLGYDLSELNKSHLDLNNIVDQLASTTTQAEEDVNQYDTSLKECKD
ELNETLDTSSLSSIVSSLLTSTTAMQIAMEQMKQQITASQCEIASLQDRLALVTIEAVTD
PLTGLANRKGLSMAINESLSTALQSKNYPCLLLLDIDYFKKINDSFGHLVGDKAIKILAD
TLKKQLKGKDTAARYGGEEFAILLPETDLQNAWKVGENIRRVVESLRITRSNNHEEVFRM
TISIGIARYQANQSINDLIELADNALYQSKNTGRNRVTIFETKL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaaatagctcgtcaatcaagtccagcacagacatcctaaagcaagcgatacaa
tttatcggccagcacaacattactgcgatacctataaactacacagtaagttacgaatat
tgtcgtggtcatcacgttctattacgacaagcaattgatcaggccatcgtaaataagcaa
ccgatcactaatgaagcgattcagggttggtttgacgcttttttgctcggttatgattta
agtgaattaaataaatcgcatttagacctgaataacatcgtcgatcaattggcatcaaca
accacccaggctgaagaagatgtcaaccagtacgatacgtcgttgaaagagtgtaaagac
gaattaaatgagaccttagatacatcatcgctctcgtcgattgtttcatcgttgcttacc
agcaccactgcgatgcagattgcgatggaacaaatgaaacagcaaattaccgccagtcag
tgcgaaatcgcttcgttacaagatcgtttagccttggtaactatagaagccgtaacagac
ccattgacaggtttagccaatcgaaaaggcttatcgatggctatcaacgaatcgttgagt
actgcgcttcaatcaaaaaattatccttgtctactgttgttggatatcgattattttaaa
aaaataaacgatagtttcggtcatttggtcggcgataaagccataaaaatattagcagat
acgttaaagaaacagctcaaaggcaaggataccgcggcgcgttacggcggtgaagagttt
gcaattttgctgccagaaactgacctacaaaatgcttggaaagttggagaaaatattcgg
cgggttgttgagagcttgaggatcaccaggagcaacaatcatgaggaagtttttcgtatg
accatttccattggcatagcccgctatcaagctaatcaaagcattaacgacttgatcgaa
ctggcagacaatgcgctgtatcaatccaaaaacacagggcgcaaccgagtcactatcttc
gagacaaaactttag

DBGET integrated database retrieval system