KEGG   Methylomonas methanica: Metme_3442
Entry
Metme_3442        CDS       T01511                                 

Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
mmt  Methylomonas methanica
Pathway
mmt03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mmt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Metme_3442
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmt02044]
    Metme_3442
Secretion system [BR:mmt02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Metme_3442
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C DUF4340 AAA_24
Other DBs
NCBI-ProteinID: AEG01811
UniProt: G0A717
Position
complement(3805083..3808628)
AA seq 1181 aa
MGKLKAFFTNKWVIQFLGLLAFSILIWLAGPLIAFAGSAPLESELVRILVIATVFVGWVI
FRLIMQIRAGNTEKQLVEELVANDADQVAMASEDEVDTLRKGFEEALTVLKQSRTEAKSG
SQYIYQLPWYAIIGAPGSGKTTALINSGLHFPLAEKLGKHAIKGVSGTRNCDWWFADDAV
FLDTAGRYTTQESHQAVDAAGWAGFLNLIKKHRPLRPLNGVIVATSISDLLQQSEQERVE
HAKAIRNRINELYQQLGVRLPVYLLFTKADLVAGFSDFFADLAPEQRAQVWGETFSATTL
QGDHDVVTQFGDAYAELLQRLQMRTLNRIQDERDMQRRGAILDFPQQMALLKPAMLDFLQ
ATFAVNRYEQAVLLRGVYFTSGTQEGTPIDRVLGILASAFRLDRQAAPMYSGQGKSFFLT
RLLKDVLFPEAELAGQDPKLAKRKRLMQMAAYIGSGLLFLLVIGLWTASYFNNQSILDKV
EAQIAEYHAIKSSGSDSQGNFNALLPRLNILLAIQEDYKDSGIMSRFGLSQADKIQAAAQ
HSYETILRNYFLPAIQMRLKERMQGPEANNLDVLYQLLKVYLMFNQTDKLDPATAVAWIR
ADWDRQYATDPESLGQLVLHLDNLLKLQLDPMQIDEGFVGAVRNKLTQVPLIGQIYSRFK
TEALIDQSHDFKLGKALGPDTTRVFVLSDGKDVSAYTIPGLFTAYGYTELFLKKSRDFVK
DAVEQNWVLGSQSKADVLQIQQLHGELKKLYLNEYQAAWSDLLAKLKLQSAVTTNQTAQI
LDILSRPDGPLHALLVSIDENTALTRLNKQVSDALANVAGKALAAAGAAGGQALALAQDA
AGLDTGPDPVQMVEDKFEPLRNLVAGGPDKPSALDPVLQQLKSLRDYFLQLSTANTGGQA
LQNQANLFSGAGMDVLKQAQLEFARLPEPLKTWFQIIVNSGGNKLSSAAKAQLSDMVKTG
VASPCKAALNGRYPFSSASSQDVLLADFAKLFAPSGLIDQFFQANLKTFVDTTKPVWTEM
AAEKPLGLSQASIRQFQTASKIRDAFFAVGNMPQVQFELKPQLLDNNVGTFRLQVEGQEA
VYRHGPEQSISMKWPGPNPSQGVRIVFETLDGRQVSRGKEGTWAFFRLLDEATIVQGNAP
ERFTLTFKLQGMSASYQLLAASVNNPFNLQELQSFRCPDAL
NT seq 3546 nt   +upstreamnt  +downstreamnt
atgggcaagctcaaagcattttttaccaataaatgggttattcagtttctgggtttgctg
gcgttcagtatcctgatctggctggccgggccgttgatagccttcgcgggcagtgcgccg
ctggagtcggaactggtcaggattttggtcatcgccaccgtgtttgtcggctgggtgatt
ttccggctgatcatgcagattcgggcgggtaataccgaaaaacaactggtcgaggaattg
gtcgccaacgatgccgatcaggtcgccatggcgtccgaagatgaagtggatacgctacgc
aaaggctttgaggaagcattgacggtgttgaagcaatcgcgcaccgaagcaaaatccggc
agccagtatatttatcaattaccctggtatgccatcatcggtgcgcccggttccggtaaa
accacggccttgatcaactccggtttgcattttccactggcggaaaaactgggcaagcat
gcgataaaaggcgtcagcggcacccgaaattgcgattggtggtttgccgacgacgcggtg
tttctggatacggccggccgctataccacgcaggaaagccatcaagccgtggatgcggcc
ggatgggccggctttttgaatctgatcaaaaagcatcggccgctacgccccctgaacgga
gtcatcgtcgccaccagtatttccgatctgttgcagcaatccgagcaggaacgggtcgaa
catgccaaagccattcgcaaccgcatcaacgagttgtatcaacagctgggcgtgcgtttg
ccggtgtatttgctgtttaccaaagccgatttggtagccggattcagcgactttttcgcc
gatttagccccggagcagcgggctcaagtgtggggggaaaccttttccgccaccacctta
cagggcgatcacgatgtagtgactcaattcggcgacgcttatgcggaattactgcaacgt
ttgcaaatgcgcacgctcaatcgtattcaggatgaacgcgatatgcaacgtcggggagcc
atcctggattttccgcagcagatggctttattaaagccggccatgctggattttttgcag
gcaacctttgcggtcaatcgctacgagcaagccgtgttattgcggggggtgtatttcacc
agcggcacccaggaaggcacgcccatcgaccgggtattgggtattctggccagcgccttt
cgtctggataggcaagccgcgcctatgtatagcggtcaaggtaaaagctttttcctgacc
cgtttgttaaaggatgtattgtttccggaagcggagctggccggacaagatcccaaattg
gccaaacgcaaacgcttgatgcaaatggccgcttatatcggttccggtttgctgtttttg
ctggtgatcggtttgtggaccgccagttatttcaacaaccaatcgatactggataaggtg
gaggcgcaaatcgccgaataccacgccatcaaaagcagtggcagcgatagccaaggcaat
ttcaatgccttgttgccgcgcttgaatattttgctggccatacaggaagattacaaagac
agtggcatcatgtccaggttcggcctatcgcaagccgataaaattcaggcagccgcccag
catagttacgaaaccatcctgcgtaattattttttacccgcgattcagatgcgtttgaaa
gaacgcatgcaaggacccgaagccaataatctggacgtgctctaccagctgttaaaagtc
tatttaatgttcaaccagaccgataaactcgatcccgctaccgctgtggcctggatccgc
gcggattgggacagacaatacgcgaccgacccggaaagtctggggcagttggtgctgcat
ctggataatctgctcaagctgcagctggacccgatgcagatcgatgaagggtttgtcggc
gcggtgcgtaacaagctcacgcaagtgccgctgatcgggcagatttactcccgcttcaaa
accgaggccttaatagaccaaagccacgattttaagttgggtaaagcattggggccggat
accactcgggtattcgtgttgtcggacggcaaagatgtgtcggcttataccattccgggc
ttgtttacggcctatggctacaccgagttgtttctaaaaaaaagccgggatttcgtcaag
gacgctgtagaacagaattgggtgctgggtagccagtccaaagccgacgttttgcaaatt
cagcaattacacggcgaattgaagaaactgtatttaaacgaataccaggcggcttggtct
gatttgctggctaaattgaaattacaatcggcggtcacgaccaatcagaccgcgcaaatc
ctggacattttgtcgaggcccgacggtcctctgcacgccttgttggtcagtatcgatgaa
aataccgcgctaacccgcttgaataagcaagtgagcgatgcactggccaatgttgccgga
aaagcgttggctgccgcaggtgcggcaggcggccaagcgttggcgctggcgcaggatgcc
gcaggcctggataccggcccagacccggtgcagatggtggaagacaagtttgaacccctg
cgcaatctggtagccggcggaccggacaagccgagcgccttggacccggtattgcagcaa
ttgaaaagtctgcgcgattactttctgcaactcagcactgccaataccggcggtcaggcg
ttacaaaatcaggccaatttattcagcggcgccggtatggatgtactgaaacaggcgcaa
ttggagtttgcccgcttgccggaacccttgaaaacctggttccagattatcgtcaatagc
ggcggcaataagctgtcttccgccgccaaggctcagttgagcgatatggtgaaaaccggg
gtggcgtcgccttgcaaggcggcattgaacggccgttatccgttttccagcgcttcctcg
caggatgtgttattggccgattttgccaaactgtttgcgccgtccggtttgatcgaccag
ttttttcaagccaatctgaaaacctttgtcgacaccaccaagccggtgtggacggaaatg
gccgccgagaaaccgctcggtttgtcgcaagcctcgattcgtcaatttcaaactgcctcc
aaaatacgcgatgctttttttgctgtcggcaacatgccgcaagtgcaattcgaattaaag
ccgcaattgttggataacaatgtcggcacctttcgcttgcaggtggaagggcaagaggct
gtgtatcgtcacggtcccgaacaatccatcagcatgaaatggcccggccctaaccccagt
cagggcgtgcgcatcgtgtttgaaacgctggacggacgtcaggtcagtcgcggcaaggaa
ggcacctgggcattttttcgcttgctggatgaagccaccattgtgcagggcaacgccccg
gaacggtttacccttaccttcaaattgcagggtatgagcgccagttaccaactgctggcc
gccagcgttaacaatccctttaatttacaggaactgcaaagtttccgttgccccgatgcc
ttgtga

DBGET integrated database retrieval system