KEGG   Methylomonas methanica: Metme_3445
Entry
Metme_3445        CDS       T01511                                 

Definition
(GenBank) FHA domain containing protein
  KO
K11913  type VI secretion system protein
Organism
mmt  Methylomonas methanica
Pathway
mmt03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mmt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Metme_3445
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmt02044]
    Metme_3445
Secretion system [BR:mmt02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Metme_3445
SSDB
Motif
Pfam: FHA Yop-YscD_cpl RPAP1_N
Other DBs
NCBI-ProteinID: AEG01814
UniProt: G0A720
Position
complement(3811407..3812900)
AA seq 497 aa
MVLILKVLTYKGVPSSQPISAQFEGQGGSIGRAPNNQLVLPDPEKFISRVHASIVCEAGH
YFIEDSSTGGTFLNDSDIPLQQSRAPLSDGEKIRIGEYELLATIADSATAGFAASIEQPV
RQLDFAQNSVLDGPFVPAQPAASQPKADFFSSFVEQPESSAFHQSFTPPQIAETPGNAAV
DDLDFGDLLSKLDELPGISHPASSKPAADLPPLPADFFAEETPKPAEASPFPSAVESETS
WPPFDEAPAEAPQVPPFAVSEAEPPAPQQQAVEPVFPGEPAKRYEIVEPPMPAAQPVQPQ
THNAAADDVLFREFLAGAGISDLHLLPPEQWPALMRTSGELLRAMVQGLMQVLRARAELK
SQFRVSVTTMRSVDNNPLKFTPSVDDAMKLILAPTNPGFLPPKQAVSEGFNDIMNHQIAM
TAGIQAALAEILRSFDPQLIERTQAEGVLFQKKTKCWEYYVEKYPQLKAVAQEEFFGDAF
ADAYEKQMLLLSRAAKN
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggtgttgattctcaaggtcctaacttataaaggcgtaccttccagtcagcccattagc
gctcagttcgaaggtcaaggcggctcgattggccgggcgccaaataatcaactggtttta
cccgatccggaaaaatttatttcgcgggtgcatgccagcatcgtatgcgaagccggacat
tattttattgaagatagtagtaccggcggcacttttctcaacgatagcgatatcccgttg
cagcaaagccgggcgccgttatcggacggcgaaaaaatccgcataggcgaatacgagctt
ctggccactattgccgattcggctacggccggttttgccgccagcatagaacaaccggta
aggcagttggattttgcccagaacagcgtactggacggtccgttcgtgccggctcagccc
gcggcttcccagcccaaggcggattttttttccagctttgttgaacagccggaatcttcg
gctttccatcaaagttttaccccgccgcaaatcgccgaaacaccgggtaacgcagcggta
gacgatctggacttcggcgatttgttatctaaattggatgaattgccgggtatcagtcat
cccgccagtagtaagccggccgccgatctgccgcccttgccggcggacttttttgccgaa
gaaacgcctaagccggcagaggcaagccctttcccgtccgcggtggagtccgaaacgtct
tggccgccattcgatgaagcgccggcggaagcgccgcaagttcccccattcgctgtgtcg
gaagctgagccgccggcacctcaacagcaggcggtcgagcctgttttccccggagaaccc
gcgaaacgatatgaaattgtcgagccgccaatgccggctgcgcagcctgttcagcctcag
acgcataatgctgcagcggatgacgtgttattccgcgaatttttagccggggccggcatt
agcgatctgcatttgctgccgccagaacaatggccggccctgatgagaacgtccggcgaa
cttttgcgtgccatggtgcagggtttgatgcaggtattaagagcaagggcggaattgaaa
agccagtttcgcgtctcggtgaccaccatgcgttcggtcgataacaatccgctaaaattt
acgccgagcgtggacgatgccatgaaactgatcctggcacccaccaaccccgggtttttg
ccgcccaagcaagctgtcagtgaaggatttaacgacatcatgaaccatcagattgccatg
accgccggtatacaggcggcgttggcggaaatactgcgcagtttcgatccgcaactgatt
gaaaggacgcaagccgagggtgttttgtttcagaaaaagaccaagtgctgggaatattat
gttgaaaaatatccgcagctcaaagcggtcgcgcaggaagagttttttggcgacgcgttt
gccgatgcctatgaaaaacaaatgctgttactaagccgggcagcgaaaaattaa

DBGET integrated database retrieval system