KEGG   Methylomonas methanica: Metme_3726Help
Entry
Metme_3726        CDS       T01511                                 

Definition
(GenBank) Polyphosphate--glucose phosphotransferase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
mmt  Methylomonas methanica
Pathway
mmt00010  Glycolysis / Gluconeogenesis
mmt00520  Amino sugar and nucleotide sugar metabolism
mmt01100  Metabolic pathways
mmt01110  Biosynthesis of secondary metabolites
mmt01120  Microbial metabolism in diverse environments
mmt01130  Biosynthesis of antibiotics
mmt01200  Carbon metabolism
Module
mmt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metme_3726
   00520 Amino sugar and nucleotide sugar metabolism
    Metme_3726
Enzymes [BR:mmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Metme_3726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N
Motif
Other DBs
NCBI-ProteinID: AEG02084
UniProt: F9ZWS2
Position
4135408..4136148
Genome map
AA seq 246 aa AA seqDB search
MHILGVDIGGSGIKGAVVDTVTGELITERHRIETPQPATPEAVAAVLAQLVLHFNWTGPV
GCGFPAAIQHGVARTASNISKAFIGTDIDSLFSEATNCPCYCVNDADAAGMAEMQFGEGA
GRPGVVLLVTIGTGLGSALFTDGHLIPNTELGHMYLDNGLEAERYASDAVRKVEDLGWKS
WGNRFNAFLTLMENLFWPDLIILGGGASKKFDKFKEQLKVEAPVKTAAFLNQAGIVGAAL
FAKSRL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcatattctcggcgtggatattgggggttccggcattaaaggtgccgttgtggatacc
gtaacgggcgaattgataacagagcgccatagaatagagacgccccaacccgccacgccg
gaagcggtagccgcggttttggcgcaactggtcctgcattttaactggaccggcccggtt
ggctgcgggtttccggccgccattcaacacggtgtggcccgcaccgcatcgaatatttcc
aaagcgttcataggcaccgatatcgatagcttgttttcggaagccaccaactgtccctgc
tattgcgtcaacgacgcggacgccgccggcatggcggaaatgcaattcggcgagggcgca
gggcgacccggggtagtattactggtgaccataggcaccggtttgggatcggcgcttttt
acggacggccatttaatacccaataccgaactgggccatatgtatctggataacggtctg
gaagccgaacgttacgcctctgacgcggtgcgcaaagtcgaggatctcggctggaaatcc
tggggtaaccgcttcaatgccttcctgactttaatggaaaacctgttttggcccgacttg
attattctgggcggcggcgccagcaaaaaattcgacaaattcaaggaacagctgaaagta
gaagcgccggtaaaaaccgccgcgtttttaaatcaggcaggcattgtcggcgcggccttg
ttcgcaaaatccaggctctga

DBGET integrated database retrieval system