KEGG   Methylomonas methanica: Metme_4614Help
Entry
Metme_4614        CDS       T01511                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mmt  Methylomonas methanica
Pathway
mmt00230  Purine metabolism
mmt01100  Metabolic pathways
Module
mmt_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mmt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Metme_4614
Enzymes [BR:mmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Metme_4614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_16 RsgA_GTPase KAP_NTPase AAA AAA_22 AAA_28 CPT AAA_17 Zeta_toxin Cache_3-Cache_2 ABC_tran AAA_30 AAA_24 Rad17 MMR_HSR1 PRK
Motif
Other DBs
NCBI-ProteinID: AEG02952
UniProt: G0A6G7
Position
complement(5050976..5051590)
Genome map
AA seq 204 aa AA seqDB search
MITGKLYIISAPSGAGKTSLVKQLRQEMDKLVVSVSHTTRAMRSGEAHGGDYFFVSVEAF
KAMIEQQAFLEHAQVFDNFYGTAQKTVEDNLAQGLDVILEIDWQGAQQVRKMLPDSASIF
ILPPSIDILKQRLQNRGQDNEETIARRMRDAVTEMSHYPEFDYLIVNDDFELALSQLKSI
VTANRLLQTTQQQLLAPLLENLLN
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgattactggaaaactttatattatctccgctccgtccggtgccggcaaaaccagcctg
gttaaacagcttagacaggaaatggataaactggtggtctcggtgtcgcacaccactcgc
gctatgcgtagtggagaagcccatggcggcgattattttttcgtttccgtcgaagcattt
aaagccatgatcgaacagcaggcttttcttgaacatgcccaggtattcgataatttttac
ggcaccgcgcaaaaaaccgtcgaagataacctggctcaaggtctggatgtgattttggag
atcgactggcagggcgcccagcaagtaagaaaaatgttacctgatagcgcatctattttt
attttgcctccttcaattgatattttaaaacaacgattacaaaaccgtggtcaagataac
gaagaaaccattgcccgccgcatgcgcgatgcagtgaccgaaatgagccattatcccgaa
ttcgattatttgatcgttaacgacgatttcgagttggcgttgagccagttaaaaagtatc
gttaccgccaatcgcttattacaaactactcagcaacagctactcgcaccgttgctggaa
aatttactcaactaa

DBGET integrated database retrieval system